Details for Arabidopsis Locus AT3G23150

Position : Chr3 ( 5`- 8254663 .. 8257735 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23150

Protein [Map View]
MVKEIASWLLILSMVVFVSPVLAINGGGYPRCNCEDEGNSFWSTENILETQRVSDFLIAVAYFSIPIELLYFVSCSNVPF
KWVLFEFIAFIVLCGMTHLLHGWTYSAHPFRLMMAFTVFKMLTALVSCATAITLITLIPLLLKVKVREFMLKKKAHELGR
EVGLILIKKETGFHVRMLTQEIRKSLDRHTILYTTLVELSKTLGLQNCAVWMPNDGGTEMDLTHELRGRGGYGGCSVSME
DLDVVRIRESDEVNVLSVDSSIARASGGGGDVSEIGAVAAIRMPMLRVSDFNGELSYAILVCVLPGGTPRDWTYQEIEIV
KVVADQVTVALDHAAVLEESQLMREKLAEQNRALQMAKRDALRASQARNAFQKTMSEGMRRPMHSILGLLSMIQDEKLSD
EQKMIVDTMVKTGNVMSNLVGDSMDVPDGRFGTEMKPFSLHRTIHEAACMARCLCLCNGIRFLVDAEKSLPDNVVGDERR
VFQVILHIVGSLVKPRKRQEGSSLMFKVLKERGSLDRSDHRWAAWRSPASSADGDVYIRFEMNVENDDSSSQSFASVSSR
DQEVGDVRFSGGYGLGQDLSFGVCKKVVQLIHGNISVVPGSDGSPETMSLLLRFRRRPSISVHGSSESPAPDHHAHPHSN
SLLRGLQVLLVDTNDSNRAVTRKLLEKLGCDVTAVSSGFDCLTAIAPGSSSPSTSFQVVVLDLQMAEMDGYEVAMRIRSR
SWPLIVATTVSLDEEMWDKCAQIGINGVVRKPVVLRAMESELRRVLLQADQLL*

DNA
ATGGTTAAAGAAATAGCTTCTTGGTTATTGATACTATCAATGGTGGTGTTTGTTTCTCCGGTTTTAGCTATAAACGGCGG
TGGTTATCCACGATGTAACTGCGAAGACGAAGGAAACAGTTTCTGGAGTACAGAGAACATTCTAGAAACTCAAAGAGTAA
GCGATTTCTTAATCGCAGTAGCTTATTTCTCAATCCCTATTGAGTTACTTTACTTCGTGAGTTGTTCCAATGTTCCATTC
AAATGGGTTCTCTTTGAGTTTATCGCCTTCATTGTTCTTTGTGGTATGACTCATCTTCTTCATGGTTGGACTTACTCTGC
TCATCCATTTAGATTAATGATGGCGTTTACTGTTTTCAAGATGTTGACTGCTTTAGTCTCTTGTGCTACTGCGATTACGC
TTATTACTTTGATTCCTCTGCTTTTGAAAGTTAAAGTTAGAGAGTTTATGCTTAAGAAGAAAGCTCATGAGCTTGGTCGT
GAAGTTGGTTTGATTTTGATTAAGAAAGAGACTGGCTTTCATGTTCGTATGCTTACTCAAGAGATTCGTAAGTCTTTGGA
TCGTCATACGATTCTTTATACTACTTTGGTTGAGCTTTCGAAGACTTTAGGGTTGCAGAATTGTGCGGTTTGGATGCCGA
ATGACGGTGGAACGGAGATGGATTTGACTCATGAGTTGAGAGGGAGAGGTGGTTATGGTGGTTGTTCTGTTTCTATGGAG
GATTTGGATGTTGTTAGGATTAGGGAGAGTGATGAAGTGAATGTGTTGAGTGTTGACTCGTCCATTGCTCGAGCTAGTGG
TGGTGGTGGGGATGTTAGTGAGATTGGTGCCGTGGCTGCTATTAGAATGCCGATGCTTCGTGTTTCGGATTTTAATGGAG
AGCTAAGTTATGCGATACTTGTTTGTGTTTTACCGGGCGGGACGCCTCGGGATTGGACTTATCAGGAGATTGAGATTGTT
AAAGTTGTGGCGGATCAAGTAACCGTTGCGTTAGATCATGCAGCGGTTCTTGAAGAGTCTCAGCTTATGAGGGAGAAGCT
GGCGGAACAGAACAGGGCGTTGCAGATGGCGAAGAGAGACGCGTTGAGAGCGAGCCAAGCGAGGAATGCGTTTCAGAAAA
CGATGAGCGAAGGGATGAGGCGTCCTATGCATTCGATACTCGGTCTTTTGTCGATGATTCAGGACGAGAAGTTGAGTGAC
GAGCAGAAAATGATTGTTGATACGATGGTTAAAACAGGGAATGTTATGTCGAATTTGGTGGGGGACTCTATGGATGTGCC
TGACGGTAGATTTGGTACGGAGATGAAACCATTTAGTCTGCATCGTACGATCCATGAAGCAGCTTGTATGGCGAGATGTT
TGTGTCTATGCAATGGAATTAGGTTCTTGGTTGACGCGGAGAAGTCTCTACCTGATAATGTAGTAGGTGATGAAAGAAGG
GTCTTTCAAGTGATACTTCATATAGTTGGTAGTTTAGTAAAGCCTAGAAAACGTCAAGAAGGATCTTCATTGATGTTTAA
GGTTTTGAAAGAAAGAGGAAGCTTGGATAGGAGTGATCATAGATGGGCTGCTTGGAGATCACCGGCTTCTTCAGCAGATG
GAGATGTGTATATAAGATTTGAAATGAATGTAGAGAATGATGATTCAAGTTCTCAATCATTTGCTTCTGTTTCCTCCAGA
GATCAAGAAGTTGGTGATGTTAGATTCTCCGGCGGCTATGGGTTAGGACAAGATCTAAGCTTTGGTGTTTGTAAGAAAGT
GGTGCAGTTGATTCATGGGAATATCTCGGTGGTCCCTGGCTCGGATGGTTCACCGGAGACCATGTCGTTGCTCCTTCGGT
TTCGACGTAGACCCTCCATATCTGTCCATGGATCCAGCGAGTCGCCAGCTCCTGACCACCACGCTCACCCACATTCGAAT
TCTCTGTTACGTGGCTTACAAGTTTTATTGGTAGACACCAACGATTCGAACCGGGCAGTTACACGTAAACTCTTAGAGAA
ACTCGGGTGCGATGTAACCGCGGTTTCCTCTGGATTCGATTGCCTTACCGCCATTGCTCCCGGCTCGTCCTCGCCTTCTA
CTTCGTTTCAAGTGGTGGTGCTTGATCTTCAAATGGCAGAGATGGACGGTTATGAAGTGGCCATGAGGATCAGGAGTCGA
TCTTGGCCGTTGATTGTGGCGACGACAGTGAGCTTGGATGAAGAAATGTGGGACAAGTGTGCACAGATTGGAATCAATGG
AGTTGTGAGAAAGCCAGTGGTGTTAAGAGCTATGGAGAGTGAGCTCCGAAGAGTATTGTTGCAAGCTGACCAACTTCTCT
AA