Details for Arabidopsis Locus AT3G23145

Position : Chr3 ( 5`- 8252138 .. 8253196 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23145

Protein [Map View]
MPYSTGCKTPLSNFEAGQNYKIQDNTALVAWTTTPWILPSNLALCVNAKFVYLKIPWLGRSMNLCLITFSDFSSVTFRLV
ADDYVMNDSGTGIVHCAPVFGADDYRVCLENEIIKKIVRDFKRPDGLKDTEIDAAVDKDESLKNEGVAREVNKCNRSD*

DNA
ATGCCTTATAGTACTGGTTGTAAAACACCACTATCTAATTTTGAAGCTGGTCAGAACTATAAGATCCAAGATAATACGGC
TCTTGTGGCATGGACTACTACTCCATGGATTCTTCCAAGTAATCTTGCTTTGTGTGTCAATGCAAAGTTTGTCTATCTTA
AGATTCCTTGGTTGGGAAGAAGTATGAACCTTTGTTTGATTACTTTTAGCGATTTCTCAAGTGTGACTTTTCGACTAGTA
GCAGATGATTATGTCATGAATGATAGTGGTACTGGTATTGTCCATTGTGCTCCTGTCTTTGGTGCAGATGACTATCGTGT
TTGTCTTGAGAACGAGATAATTAAGAAGATTGTCAGAGATTTCAAACGTCCAGATGGTTTGAAAGATACAGAGATTGATG
CAGCTGTAGATAAAGATGAATCTTTGAAAAACGAAGGTGTTGCCCGTGAGGTAAATAAATGTAACCGAAGCGATTAA