Details for Arabidopsis Locus AT3G23140

Position : Chr3 ( 5`- 8250579 .. 8251097 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23140

Protein [Map View]
MNHRDKQIDSGSGSGENRRTYDCDICKRGFTNPQALGGHNNIHRRERERYPSSSSSSHSFPFSLPLPSQSPSSSTNFTNP
PPYFPTIESYLHQGSQPPINPSHNTQYFGSSSSSRGGGRFAQGASHDLNLSLGLGSMNEDDDTHRSPPETGGSQPQDGDL
DLDLRLGGHRHH*

DNA
ATGAACCACCGGGACAAACAAATTGATTCCGGCTCTGGCTCTGGAGAAAACCGCCGGACTTATGACTGCGACATCTGCAA
GAGAGGTTTCACGAATCCTCAAGCCCTCGGTGGTCACAATAACATCCACCGCAGGGAACGCGAAAGATACCCCTCCTCCT
CTTCTTCTTCTCACTCATTTCCATTTTCTCTTCCGTTACCATCTCAGTCTCCCTCCTCCTCCACAAACTTCACAAACCCT
CCTCCTTATTTTCCGACCATTGAGTCATACCTACACCAAGGGTCTCAGCCACCTATTAACCCTAGCCACAACACACAATA
CTTTGGATCATCATCATCATCAAGAGGAGGAGGGAGATTTGCTCAAGGGGCGTCTCATGATCTTAATTTGAGCTTAGGGC
TCGGATCCATGAATGAAGATGATGACACTCACCGGAGCCCACCAGAGACCGGAGGTTCTCAACCTCAAGATGGTGATCTT
GATCTTGATCTTCGACTCGGCGGTCATCGTCATCATTAA