Details for Arabidopsis Locus AT3G23100

Position : Chr3 ( 5`- 8220682 .. 8226400 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23100

Protein [Map View]
MIGVDSKSSSTTFIETMVESEKTKHTCLRLEISGADPIFVKGTWHNSRFDISVTDGSSSWICNATEEEVAERAAQWDQPV
SEYLKLAEQYLGFQQPNSVYSFSDALEGSKRLSWTFEKEGTKLEWRWKCKPSDDSKKITVGILDFLMEANIRLSEEVVNK
TRSFEKMRSEAERCLAQGEKLCDEKTEFESATYAKFLSVLNAKKAKLRALRDKEDSVRVVEEEESTDKAESFESGRSDDE
KSEEEASKKATSSKARGGKRAARS*

DNA
ATGATCGGAGTTGACTCAAAATCTTCGTCGACGACTTTTATCGAAACAATGGTTGAATCGGAGAAAACGAAACACACTTG
TCTCCGTCTCGAAATCTCCGGCGCCGATCCAATTTTCGTCAAAGGCACTTGGCATAATTCTCGTTTCGATATCTCCGTCA
CCGATGGTTCCTCCTCTTGGATTTGCAATGCGACGGAGGAGGAAGTGGCGGAGAGAGCAGCACAATGGGACCAGCCTGTG
TCAGAGTATTTAAAGCTCGCCGAGCAATACTTAGGGTTTCAACAACCTAATTCGGTCTATAGTTTCTCCGATGCTCTAGA
GGGATCTAAACGGCTCTCTTGGACGTTTGAGAAGGAAGGGACTAAACTTGAGTGGAGGTGGAAATGTAAACCATCAGATG
ATAGCAAGAAGATCACTGTTGGGATCTTGGATTTTCTTATGGAGGCTAACATAAGGCTAAGTGAAGAAGTGGTGAACAAG
ACGAGATCTTTTGAGAAGATGAGAAGTGAAGCTGAGAGATGTCTAGCGCAAGGTGAAAAACTCTGTGACGAAAAAACAGA
GTTTGAGAGTGCAACTTATGCAAAGTTTCTTTCTGTTTTAAATGCAAAGAAGGCAAAACTGAGAGCACTAAGGGACAAAG
AAGATTCAGTGAGAGTAGTTGAGGAGGAAGAGTCGACAGACAAAGCTGAAAGCTTTGAGAGTGGAAGAAGTGATGATGAG
AAGAGCGAGGAAGAAGCCTCAAAAAAGGCAACAAGCAGCAAAGCCCGTGGCGGGAAGAGAGCTGCACGAAGCTAA