Details for Arabidopsis Locus AT3G23090

Position : Chr3 ( 5`- 8214301 .. 8217087 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23090

Protein [Map View]
MDICMDKEPDGVVVYANGDSCNPNQENVSEPLLDSVSRDDANVHTELRYGEENIEVNEYDVKECTSEIPVGKPIGDDFES
KDVTKSSLHAKHASKSGRGNNKTRNTVPQPFSLATEKRASSTRSFTSESLESAGLKKFPDGHSKVQSQATKVPRKPLQPK
NKKLSDEEDSCSVASYATSGAKSAKSRTVVTAAPSFRSTERAEKRKEFYTKLEEKHQAMEAEKTQSEARNKEATEAALRQ
LRKSLRFKANPMPKFYHEGPPPKVELKKPLPTRAKSPKLGRRNPKEGNRAKGASRRHETRKTLVISKEDHDDETTRNADQ
INHKEMNRNLEPETAFAC*

DNA
ATGGATATCTGTATGGACAAGGAGCCAGATGGTGTGGTGGTCTATGCGAACGGTGATTCGTGTAATCCAAACCAAGAAAA
TGTTTCTGAGCCTCTCTTAGATTCAGTATCACGCGATGATGCTAATGTACATACAGAGCTTCGATATGGGGAAGAGAACA
TCGAAGTAAACGAATATGATGTTAAAGAGTGTACTAGTGAGATCCCCGTTGGTAAGCCGATAGGAGATGATTTTGAGTCT
AAAGATGTCACTAAGTCAAGTTTACATGCAAAGCATGCTTCAAAATCAGGTAGAGGGAATAACAAAACAAGGAACACCGT
TCCACAACCGTTTTCTTTAGCAACTGAGAAACGTGCTTCATCTACACGTTCGTTTACTAGTGAATCTCTCGAATCAGCTG
GCTTGAAAAAGTTTCCGGATGGACATAGTAAAGTACAAAGTCAGGCAACAAAGGTACCTAGGAAACCATTGCAGCCAAAA
AACAAGAAGCTTTCAGATGAGGAAGATTCTTGCTCTGTTGCTTCATATGCCACGTCGGGTGCAAAGTCTGCTAAATCAAG
AACTGTTGTCACCGCAGCTCCTTCGTTCCGATCCACTGAGCGTGCCGAGAAGAGGAAGGAGTTCTATACAAAACTGGAGG
AGAAACACCAAGCCATGGAGGCCGAGAAAACGCAAAGTGAAGCAAGGAACAAGGAAGCAACCGAAGCAGCTTTAAGACAA
TTAAGAAAAAGTTTGAGGTTTAAAGCAAACCCAATGCCAAAATTTTATCATGAAGGGCCTCCCCCAAAGGTTGAACTTAA
GAAGCCTCTTCCAACTCGAGCAAAGTCGCCAAAACTAGGGCGGAGGAACCCGAAAGAAGGAAACAGAGCAAAAGGAGCTT
CGAGGCGGCATGAAACTCGAAAGACTCTAGTGATCTCTAAAGAAGACCATGATGATGAAACCACACGGAATGCTGACCAG
ATAAACCATAAAGAAATGAACCGAAATTTGGAACCAGAGACTGCTTTTGCCTGCTAA