Details for Arabidopsis Locus AT3G23080

Position : Chr3 ( 5`- 8207287 .. 8209329 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23080

Protein [Map View]
MDIFMDFFNKPSVTETFVDVLLCAVPIWVTVMIGLLIGWSWRPRWTSLVYLGFRSKLRFLCTVPPGFGARRIWLAFTALS
AFSVCSTSNKSSVNNGSSKPVEEEAFSRASDKVTEKEKDVVTEKDLEHLLHLLEAGNASFEWQSMMDKSTPNMSYQAWRH
EPEIGPVVYRSRTVFEDVTPDIVRDFFWDDEFRPKWDTMLAYFKTLEEDPKTGTTIVHWIKKFPFFCSDREYIIGRRIWE
SGRKYYAVTKGVPYKALSKRDKPRRVELYFSSWIINAVESRKGDGQMTACEVSLVHYEDMGIPKDVAKLGVRHGMWGAVK
KLNSGLRAYQSARKPGTSLSRSAQMASITTKLNMDLVETSGAEDEERGRAVENARKQNDQFGVDWKWIVVGGVALACGLH
SSAIGKALMVGAGQRLARR*

DNA
ATGGATATTTTCATGGATTTCTTCAATAAACCTTCTGTTACAGAGACATTCGTCGACGTTTTGCTATGTGCAGTTCCGAT
TTGGGTCACTGTTATGATCGGGCTTCTGATCGGTTGGTCTTGGCGTCCTAGATGGACTAGCTTGGTTTATTTAGGTTTCC
GTTCTAAGCTTCGGTTTCTATGTACTGTTCCTCCTGGATTTGGTGCTCGTCGTATTTGGCTTGCTTTCACCGCTCTCTCT
GCTTTTTCCGTTTGTTCAACCTCCAATAAATCCTCGGTTAATAACGGTTCCTCTAAACCGGTCGAAGAAGAAGCATTTTC
ACGAGCTAGTGATAAAGTTACAGAGAAAGAGAAAGATGTTGTGACAGAGAAGGATTTAGAGCATTTGTTGCATCTGCTTG
AAGCTGGAAATGCTAGTTTTGAGTGGCAATCTATGATGGATAAGTCTACTCCGAATATGAGCTATCAAGCTTGGCGTCAT
GAGCCTGAGATAGGTCCTGTTGTTTATCGTAGTCGAACTGTTTTTGAGGATGTAACACCAGACATTGTTAGGGATTTCTT
CTGGGACGATGAGTTTCGACCTAAATGGGATACTATGCTTGCTTACTTCAAAACTTTAGAGGAAGATCCTAAGACAGGAA
CTACCATTGTTCATTGGATTAAAAAGTTCCCATTCTTCTGTAGTGACCGGGAATACATCATTGGTAGGAGAATATGGGAA
TCTGGAAGAAAATATTATGCTGTGACTAAGGGAGTACCGTATAAAGCTTTATCAAAGCGTGATAAGCCGAGGCGAGTCGA
ACTTTATTTCTCAAGTTGGATTATCAATGCAGTTGAATCAAGAAAAGGTGATGGGCAAATGACAGCTTGTGAAGTCTCTC
TTGTTCACTACGAAGACATGGGAATCCCAAAAGATGTAGCAAAGTTAGGAGTCCGTCATGGCATGTGGGGAGCTGTAAAG
AAGCTAAACTCTGGCTTAAGGGCGTACCAAAGCGCTAGAAAACCTGGGACGTCGCTCTCACGGAGTGCGCAGATGGCAAG
TATCACCACAAAGCTGAACATGGATTTGGTGGAAACATCTGGGGCAGAGGACGAAGAGAGAGGACGAGCAGTAGAGAATG
CGAGGAAACAAAATGATCAGTTCGGTGTAGACTGGAAATGGATCGTTGTAGGAGGAGTAGCTTTGGCTTGTGGGCTTCAT
TCTAGTGCTATAGGTAAGGCGTTAATGGTTGGAGCTGGACAGAGACTTGCTCGTAGGTGA