Details for Arabidopsis Locus AT3G23050

Position : Chr3 ( 5`- 8194679 .. 8197153 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23050

Protein [Map View]
MIGQLMNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAK
AQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFS
SFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCK
NRS*

DNA
ATGATCGGCCAACTTATGAACCTCAAGGCCACGGAGCTCTGTCTCGGCCTCCCCGGCGGCGCTGAAGCAGTTGAGAGTCC
TGCCAAATCGGCGGTGGGAAGCAAGAGAGGCTTCTCCGAAACCGTTGATCTCATGCTCAATCTTCAATCTAACAAAGAAG
GCTCCGTTGATCTCAAAAACGTTTCTGCTGTTCCCAAGGAGAAGACTACCCTTAAAGATCCTTCTAAGCCTCCTGCTAAA
GCACAAGTGGTGGGATGGCCACCTGTGAGGAACTACAGGAAGAACATGATGACTCAGCAGAAGACCAGTAGTGGTGCGGA
GGAGGCCAGCAGTGAGAAGGCCGGGAACTTTGGTGGAGGAGCAGCCGGAGCCGGCTTGGTGAAGGTCTCCATGGACGGTG
CTCCATATCTGAGGAAAGTTGACCTCAAGATGTACAAAAGCTACCAGGATCTTTCTGATGCATTGGCCAAAATGTTCAGC
TCCTTTACTATGGGAAACTATGGAGCACAAGGAATGATAGATTTCATGAACGAGAGCAAGCTAATGAATCTGCTGAATAG
CTCTGAGTATGTGCCAAGCTACGAGGACAAAGATGGTGACTGGATGCTCGTTGGCGATGTCCCATGGGAAATGTTTGTCG
AGTCTTGCAAACGTTTGCGCATTATGAAGGGATCTGAAGCAGTTGGACTTGCTCCGAGAGCAATGGAGAAGTACTGCAAG
AACAGATCTTGA