Details for Arabidopsis Locus AT3G23030

Position : Chr3 ( 5`- 8180768 .. 8181800 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23030

Protein [Map View]
MAYEKVNELNLKDTELCLGLPGRTEKIKEEQEVSCVKSNNKRLFEETRDEEESTPPTKTQIVGWPPVRSSRKNNNSVSYV
KVSMDGAPYLRKIDLKTYKNYPELLKALENMFKVMIGEYCEREGYKGSGFVPTYEDKDGDWMLVGDVPWDMFSSSCKRLR
IMKGSDAPALDSSL*

DNA
ATGGCGTACGAGAAAGTCAACGAGCTTAACCTTAAGGACACAGAGCTATGTCTTGGATTACCCGGAAGAACAGAGAAGAT
CAAAGAAGAACAAGAGGTTTCTTGCGTTAAAAGTAACAACAAGCGTCTATTTGAGGAAACTCGTGATGAAGAAGAATCTA
CACCTCCTACCAAAACTCAAATCGTTGGTTGGCCACCAGTGAGATCTTCCCGTAAGAACAACAACAGTGTGAGCTACGTG
AAAGTGAGTATGGACGGAGCTCCTTACCTTCGCAAGATCGATCTCAAGACATACAAAAACTACCCCGAGCTTCTCAAAGC
GTTAGAGAATATGTTCAAAGTCATGATTGGTGAATATTGTGAGAGAGAAGGATACAAAGGATCTGGATTTGTACCAACAT
ACGAAGATAAAGATGGTGACTGGATGTTGGTTGGTGATGTTCCATGGGACATGTTCTCTTCTTCTTGTAAGAGACTCAGA
ATCATGAAGGGATCCGACGCTCCTGCTCTAGACTCTTCCTTATGA