Details for Arabidopsis Locus AT3G23000

Position : Chr3 ( 5`- 8172597 .. 8174131 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G23000

Protein [Map View]
MESLPQPQNQSSPATTPAKILLGKYELGRRLGSGSFAKVHLARSIESDELVAVKIIEKKKTIESGMEPRIIREIDAMRRL
RHHPNILKIHEVMATKSKIYLVMELASGGELFSKVLRRGRLPESTARRYFQQLASALRFSHQDGVAHRDVKPQNLLLDEQ
GNLKVSDFGLSALPEHLQNGLLHTACGTPAYTAPEVISRRGYDGAKADAWSCGVILFVLLVGDVPFDDSNIAAMYRKIHR
RDYRFPSWISKQAKSIIYQMLDPNPVTRMSIETVMKTNWFKKSLETSEFHRNVFDSEVEMKSSVNSITAFDLISLSSGLD
LSGLFEAKKKKERRFTAKVSGVEVEEKAKMIGEKLGYVVKKKMMKKEGEVKVVGLGRGRTVIVVEAVELTVDVVVVEVKV
VEGEEDDSRWSDLITELEDIVLSWHNDIM*

DNA
ATGGAATCACTTCCCCAGCCGCAAAACCAATCATCTCCGGCAACAACTCCGGCGAAGATCCTCCTTGGGAAATACGAACT
CGGTCGTCGTCTCGGTAGCGGAAGCTTCGCGAAAGTCCATTTAGCTCGATCAATCGAATCCGACGAGCTCGTCGCCGTTA
AAATCATCGAGAAGAAGAAAACAATCGAATCCGGTATGGAACCAAGAATAATCAGAGAGATCGATGCGATGCGTCGTCTT
CGTCATCATCCAAACATACTCAAGATCCATGAAGTTATGGCAACCAAATCTAAGATCTATCTCGTAATGGAACTCGCTTC
CGGTGGTGAACTTTTCTCAAAAGTCCTCCGTCGTGGACGTCTTCCTGAATCAACGGCGCGTCGTTACTTTCAACAACTCG
CCTCCGCTCTTCGTTTCTCTCACCAAGACGGTGTCGCTCACCGTGATGTGAAACCTCAGAATCTACTCTTAGATGAGCAA
GGTAACCTCAAGGTCTCTGACTTTGGTTTATCAGCTTTACCGGAGCATCTACAAAACGGATTGCTTCACACGGCGTGTGG
TACTCCGGCTTATACAGCTCCGGAGGTTATTTCACGGAGGGGATACGACGGAGCAAAAGCTGATGCGTGGTCTTGTGGTG
TGATTTTGTTTGTTTTATTGGTTGGCGATGTTCCATTTGATGATTCGAATATCGCTGCGATGTATCGGAAGATTCATCGG
AGAGATTATCGGTTTCCGAGCTGGATTTCGAAACAAGCTAAATCGATAATCTATCAGATGTTAGATCCGAATCCAGTAAC
GAGGATGAGTATTGAAACAGTGATGAAAACGAATTGGTTCAAGAAGTCTCTAGAGACTTCTGAGTTTCATCGTAACGTCT
TTGATTCGGAAGTAGAGATGAAATCGAGTGTTAATTCGATTACTGCTTTTGATTTGATCTCGTTATCGTCGGGATTAGAT
CTTTCTGGATTGTTTGAGGCTAAGAAGAAGAAGGAGAGGAGATTCACGGCGAAGGTTTCGGGTGTTGAAGTGGAGGAGAA
GGCGAAGATGATTGGGGAGAAGTTAGGTTATGTAGTGAAGAAGAAGATGATGAAGAAGGAAGGAGAAGTGAAGGTTGTTG
GATTAGGGAGAGGAAGAACTGTGATTGTGGTGGAAGCAGTGGAGTTAACGGTGGATGTTGTGGTGGTTGAAGTGAAAGTT
GTTGAAGGTGAAGAAGATGATTCACGGTGGTCTGATTTGATTACTGAGCTTGAAGATATAGTTCTTTCATGGCACAATGA
CATCATGTAA