Details for Arabidopsis Locus AT3G22990

Position : Chr3 ( 5`- 8163950 .. 8166345 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22990

Protein [Map View]
MQKRELGKSGGNSGGSSGPPAKRGRPFGSTSANSAAAAAAAAAADAMSPSALLGPSLLVHNSFVEQNNRRIVLALQSGLK
SEVTWALNTLTLLSFKEKEDIRRDVMPLAKIAGLLDALLLIIDDWRDIALPKDLTRGTRVRTLGTNASVTGFGNEYDALA
SIQPPGSGIGSSAAEALGKKSTGKHQSSQWWMEEDGLFNLDDEGRSEKQMCAIAASNVIRNFSFMPDNEVVMAQHRHCLE
TVFQCIHDHMTEDEELVTNSLETIVNLAHLMDLRIFSSLKQSYININEKKAVQAVVGILNSSVKAWNCAAAELLGRLIIN
PDNEPFISPLIPQIHKRLIDLLSIQAVDAQAAAVGALYNLVEVNMDCRLKLASERWAVDRLLKVIKTPHPVPEVCRKAAM
ILENLVSEPQNRGLLLAYENAFAELLFQEGKYSDSFARILYELTARSNSRVASARGIWGM*

DNA
ATGCAGAAACGGGAGCTTGGGAAATCCGGCGGTAATTCCGGTGGATCTTCGGGTCCACCAGCGAAGAGAGGCCGTCCCTT
CGGTAGTACAAGTGCTAACTCAGCTGCTGCTGCTGCAGCGGCGGCAGCAGCGGACGCGATGTCACCGTCAGCTTTACTTG
GTCCTTCTCTTCTAGTTCACAATTCCTTCGTCGAGCAGAACAATAGAAGAATAGTTCTTGCGTTGCAGAGTGGTTTGAAG
AGTGAGGTGACATGGGCATTGAACACACTTACGTTGCTTTCCTTCAAGGAAAAAGAAGATATTCGAAGAGATGTCATGCC
TCTTGCTAAGATAGCTGGCTTGCTTGATGCCCTTCTCTTAATTATAGATGATTGGCGTGACATAGCTCTCCCAAAGGACC
TGACAAGAGGAACTAGAGTTAGAACTTTAGGTACAAATGCTTCAGTTACGGGATTTGGCAATGAGTATGATGCTCTAGCC
TCTATTCAACCCCCTGGATCCGGGATTGGTTCTTCTGCTGCTGAGGCATTAGGAAAAAAGAGCACTGGTAAACATCAGTC
ATCTCAGTGGTGGATGGAAGAGGATGGTTTGTTTAATCTAGACGATGAAGGGAGATCAGAGAAACAAATGTGTGCTATTG
CTGCATCGAACGTTATCCGCAACTTCTCCTTCATGCCTGATAATGAAGTTGTAATGGCTCAGCATCGCCATTGCTTAGAA
ACTGTTTTCCAGTGCATACACGATCATATGACCGAGGATGAAGAGCTGGTCACAAACTCGCTAGAGACAATTGTAAACCT
AGCGCATTTGATGGATCTTCGAATTTTCAGCTCGCTTAAGCAGTCATACATCAACATAAATGAAAAGAAAGCTGTTCAAG
CTGTGGTCGGAATCCTCAATTCTTCTGTCAAAGCTTGGAATTGTGCTGCTGCTGAGTTGCTAGGGCGTTTGATAATCAAT
CCGGACAATGAACCTTTCATTAGTCCTTTAATTCCGCAGATACACAAGCGACTAATCGATCTTTTGAGCATACAAGCCGT
TGATGCACAAGCTGCAGCTGTTGGAGCACTCTACAATCTCGTGGAAGTTAACATGGATTGCAGATTAAAGCTAGCAAGTG
AGAGATGGGCGGTTGATAGGTTGCTGAAAGTGATAAAGACTCCGCATCCGGTTCCAGAAGTATGTAGGAAAGCTGCAATG
ATCCTTGAGAACCTTGTCTCGGAGCCTCAAAACAGAGGATTGCTACTCGCGTATGAGAATGCTTTCGCTGAGCTGCTTTT
TCAAGAGGGTAAGTATTCTGATTCATTTGCTAGGATTTTGTATGAACTCACTGCTAGATCTAATAGCAGAGTTGCTTCAG
CTAGAGGAATCTGGGGCATGTAA