Details for Arabidopsis Locus AT3G22950

Position : Chr3 ( 5`- 8136181 .. 8138084 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22950

Protein [Map View]
MGAFMSRFWFMMFPAKEYKIVVVGLDNAGKTTTLYKLHLGEVVTTHPTVGSNVEELVYKNIRFEVWDLGGQDRLRTSWAT
YYRGTHAVIVVIDSTDRARISFMKDELARLLGHEDLQNSVILVFANKQDLKDAMTPAEITDALNLHSIKNHDWHIQASCA
VTGEGLYDGLGWIAQKVTGKATS*

DNA
ATGGGAGCATTCATGTCGAGGTTTTGGTTCATGATGTTTCCTGCAAAAGAGTATAAGATTGTTGTTGTTGGTTTGGATAA
TGCTGGTAAAACGACGACGCTTTATAAACTTCATTTGGGTGAAGTTGTTACTACTCATCCTACTGTTGGTAGCAATGTTG
AAGAGCTTGTCTACAAGAATATTCGCTTTGAGGTATGGGATCTTGGTGGGCAAGATAGGCTAAGAACTTCATGGGCAACA
TACTATCGTGGAACACATGCTGTGATTGTGGTTATAGATAGCACAGACAGAGCCAGAATCTCTTTCATGAAAGATGAGCT
AGCCAGGTTACTTGGTCATGAGGATCTTCAAAACTCGGTCATACTAGTTTTTGCAAACAAACAGGATCTGAAAGACGCAA
TGACTCCTGCTGAGATCACGGATGCACTTAACCTTCACAGTATCAAGAACCATGATTGGCATATTCAAGCAAGTTGTGCG
GTTACTGGAGAAGGATTGTATGATGGGCTCGGTTGGATTGCCCAAAAAGTTACCGGTAAAGCCACGAGTTAA