Details for Arabidopsis Locus AT3G22942

Position : Chr3 ( 5`- 8134190 .. 8136204 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22942

Protein [Map View]
MEAGSSNSSGQLSGRVVDTRGKHRIQAELKRLEQEARFLEEELEQLEKMDNASASCKEFLDSVDSKPDPLLPETTGPVNA
TWDQWFEGPKEAKRCGCSIL*

DNA
ATGGAAGCGGGTAGCTCCAATTCGTCGGGTCAGCTATCCGGGCGGGTCGTTGATACAAGAGGCAAACACAGGATTCAAGC
TGAACTCAAAAGGCTTGAACAAGAAGCTCGATTCTTAGAGGAAGAGCTGGAGCAGCTTGAGAAGATGGACAATGCATCAG
CATCCTGCAAAGAGTTCTTAGACAGTGTTGACAGCAAACCCGATCCTCTTCTTCCCGAAACAACAGGTCCGGTGAATGCG
ACATGGGATCAATGGTTCGAAGGCCCTAAAGAAGCAAAACGATGTGGCTGCTCCATTCTTTGA