Details for Arabidopsis Locus AT3G22930

Position : Chr3 ( 5`- 8124083 .. 8125931 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22930

Protein [Map View]
MEEIQQQQQQQQQQQQQQQQQQQQQQELTQEQIMEFKEAFCLFDKDGDGCITADELATVIRSLDQNPTEQELQDMITEID
SDGNGTIEFSEFLNLMANQLQETDADEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVDQMIKEADLDGDGQV
NYDEFVRMMMING*

DNA
ATGGAAGAAATTCAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAACAAGA
ACTGACGCAAGAACAGATAATGGAGTTCAAAGAGGCTTTTTGTCTATTCGACAAAGATGGTGATGGATGCATCACTGCTG
ATGAACTTGCCACTGTGATCCGCTCATTGGATCAGAACCCTACCGAGCAAGAACTTCAAGATATGATCACTGAGATCGAC
TCCGATGGCAACGGCACCATCGAATTTTCGGAGTTTCTCAACCTCATGGCTAACCAACTCCAGGAAACTGATGCAGATGA
AGAGCTGAAAGAAGCATTCAAAGTGTTTGACAAAGACCAAAATGGTTACATCTCTGCCAGTGAGTTGAGGCATGTGATGA
TTAATCTTGGGGAGAAGCTAACAGATGAAGAGGTTGATCAAATGATAAAAGAGGCAGATTTGGATGGTGATGGCCAAGTC
AATTATGATGAATTTGTCAGGATGATGATGATCAATGGTTAA