Details for Arabidopsis Locus AT3G22920

Position : Chr3 ( 5`- 8122713 .. 8123411 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22920

Protein [Map View]
MANPKVFFDLTVDGKPAGRIVIELFADLTPRTAENFRGLCTGERGIGKCGKPIHYKGSTFDHIVPDLMWCGGDIIFENEP
IHSEELDDEYFILNHEDGPGIISMADSNGSQFQIHMKDYGLQVDGDHVVIGKVVEGLDLMRNIEKEVITTTTRTPSKPVV
IADCGELSDYRSERCYLMKNIEKEVIIKTAKDNKPVVIADCGGLSDDRSERYYLINIVVACMVLMCFWSWFV*

DNA
ATGGCTAACCCTAAAGTTTTCTTTGATTTGACCGTGGATGGCAAACCCGCTGGTCGGATCGTGATAGAGCTCTTCGCTGA
CTTGACTCCACGGACGGCGGAGAACTTCAGGGGTCTGTGTACCGGCGAGAGAGGCATCGGAAAGTGTGGTAAACCAATCC
ACTACAAAGGATCAACCTTCGACCATATTGTTCCCGATCTCATGTGGTGTGGAGGAGATATCATCTTCGAAAACGAACCC
ATCCACAGCGAAGAATTAGACGACGAGTACTTTATCTTGAACCACGAAGACGGTCCAGGTATCATCTCCATGGCCGACTC
CAACGGATCTCAGTTCCAAATCCACATGAAGGACTATGGCTTGCAAGTGGACGGTGATCACGTTGTGATCGGCAAAGTTG
TTGAAGGATTGGATCTTATGAGGAACATTGAGAAGGAGGTCATAACTACGACAACAAGGACGCCTTCAAAGCCTGTGGTG
ATCGCGGACTGCGGTGAGCTTTCAGATTATAGGTCAGAAAGATGTTATCTTATGAAGAACATTGAGAAGGAGGTCATAAT
TAAAACAGCAAAGGATAACAAGCCCGTGGTGATTGCGGACTGCGGTGGGCTTTCAGATGATAGATCTGAAAGATATTATC
TTATAAATATAGTTGTTGCTTGCATGGTTTTGATGTGTTTTTGGTCTTGGTTCGTTTAA