Details for Arabidopsis Locus AT3G22900

Position : Chr3 ( 5`- 8115177 .. 8116253 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22900

Protein [Map View]
MFIKVKLPWDVTIPAEDMDTGLMLQRAIVIRLLEAFSKEKATKDLGYLITPTILENIGEGKIKEQTGEIQFPVVFNGICF
KMFKGEIVHGVVHKVHKTGVFLKSGPYEIIYLSHMKMPGYEFIPGENPFFMNQYMSRIQIGARVRFVVLDTEWREAEKDF
MALASIDGDNLGPF*

DNA
ATGTTCATCAAAGTGAAATTGCCATGGGATGTTACGATTCCAGCTGAAGATATGGACACTGGCCTTATGCTTCAGAGAGC
TATTGTCATTCGTCTACTCGAAGCCTTTTCTAAAGAGAAAGCAACAAAAGATCTTGGATACTTGATAACACCGACAATTC
TTGAGAACATCGGTGAGGGTAAGATCAAGGAACAGACCGGCGAAATTCAGTTTCCCGTAGTTTTTAACGGAATCTGCTTC
AAGATGTTTAAAGGAGAGATTGTTCATGGTGTGGTGCACAAGGTTCACAAGACTGGTGTCTTTTTGAAATCTGGCCCTTA
TGAAATCATTTACCTATCACACATGAAAATGCCTGGTTACGAGTTCATTCCAGGCGAGAACCCGTTTTTCATGAATCAGT
ACATGTCCCGGATTCAAATCGGTGCCAGAGTTCGTTTCGTCGTGTTAGATACCGAGTGGAGAGAGGCAGAGAAAGACTTC
ATGGCTTTGGCTAGCATCGATGGAGACAATCTTGGTCCGTTCTAA