Details for Arabidopsis Locus AT3G22880

Position : Chr3 ( 5`- 8097687 .. 8100820 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22880

Protein [Map View]
MMASLKAEETSQMQLVEREENDEDEDLFEMIDKLIAQGINAGDVKKLQEAGIHTCNGLMMHTKKNLTGIKGLSEAKVDKI
CEAAEKIVNFGYMTGSDALIKRKSVVKITTGCQALDDLLGGGIETSAITEAFGEFRSGKTQLAHTLCVTTQLPTNMKGGN
GKVAYIDTEGTFRPDRIVPIAERFGMDPGAVLDNIIYARAYTYEHQYNLLLGLAAKMSEEPFRILIVDSIIALFRVDFTG
RGELADRQQKLAQMLSRLIKIAEEFNVAVYMTNQVIADPGGGMFISDPKKPAGGHVLAHAATIRLLFRKGKGDTRVCKVY
DAPNLAEAEASFQITQGGIADAKD*

DNA
ATGATGGCTTCTCTTAAAGCTGAAGAAACGAGCCAGATGCAGCTCGTTGAGCGTGAAGAAAATGATGAAGACGAAGATCT
ATTTGAGATGATTGACAAATTGATCGCACAAGGTATAAACGCAGGAGATGTGAAAAAGCTACAAGAAGCTGGGATCCATA
CCTGCAATGGTCTCATGATGCATACCAAGAAGAACCTTACTGGAATCAAAGGTTTATCTGAGGCCAAAGTTGACAAAATC
TGTGAAGCTGCTGAGAAAATTGTGAACTTTGGATATATGACTGGAAGTGATGCTCTTATAAAGAGGAAATCAGTTGTAAA
AATCACTACAGGGTGTCAAGCTCTCGATGATCTCTTAGGAGGTGGAATTGAAACCTCAGCCATCACAGAGGCTTTTGGGG
AATTTAGGTCTGGGAAAACCCAATTAGCACATACCCTTTGTGTCACTACGCAGCTACCTACAAACATGAAAGGAGGGAAT
GGAAAAGTGGCATACATTGACACAGAGGGAACCTTCCGTCCTGATAGGATTGTCCCAATTGCTGAAAGATTTGGAATGGA
TCCAGGAGCTGTGCTTGACAATATCATTTATGCTCGTGCTTATACCTATGAGCATCAGTACAACTTGCTTCTTGGCCTTG
CTGCAAAAATGTCTGAGGAACCATTTAGGATTCTGATTGTTGACTCGATCATTGCTTTATTCCGAGTGGATTTCACTGGA
AGAGGAGAACTCGCAGACCGCCAGCAAAAACTAGCTCAGATGCTTTCCAGGCTAATCAAAATTGCAGAGGAGTTCAACGT
TGCTGTCTACATGACTAACCAAGTCATAGCTGACCCAGGTGGTGGAATGTTCATATCAGACCCAAAAAAGCCAGCAGGTG
GTCATGTACTAGCTCACGCAGCCACCATCAGGCTCTTGTTCAGGAAAGGCAAAGGCGATACACGTGTCTGCAAAGTCTAC
GATGCTCCGAATCTCGCTGAAGCTGAAGCCAGTTTCCAGATTACTCAAGGAGGCATTGCTGACGCGAAGGATTAG