Details for Arabidopsis Locus AT3G22860

Position : Chr3 ( 5`- 8090654 .. 8093248 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22860

Protein [Map View]
MTTTSRFFAQSGSESEDESDFEKEEVEGNNTRYLADLPDGEICCGMDTKRVVKPKKDKRFEEMANTIENMKHAMNINDCV
YLQETFEKLNKQISKSVKTPTLYIKTLVMLEDFLNEDNMKTKEKMSTSNSKALNAMRQKLKKNNLQYQEDIKRFRESPEI
EDDDEYEEEVVEDSADNVSWEMLFSLDHEEITWNMVNKKFKEIRAARWSKRRSSSLKLKPGETHAQKHMDLTKIAKTPAQ
KVEILFSVISAEFNVNSGGLSGYMPIDVWKKCVVNMLTILDILVKYYNIVVDDTVEPDEKETSKPAAYDGTIRVSGNLVA
FLEKIETEFFKSLQCIDPHTNDYVERLKDEPMFLALAQSIQDYLERTGDSKAASKVAFILVESIYYKPQEVFDAMSKLAD
EEIEEANEESGSSSSSFIVVAEIVPRKPTFAKSSRAMMDTLVSFIYKNGDERTKARAMLCDIYQHALMDNFVTARDLLLM
SHLQENIQHMDISTQILFNRTMAQLGLCAFRVGMITESHSCLSELYSGNRVRELLGQGVSQSRDHEKTTEQMLMERRTQI
PYHMNINLELLEAVYLTCAMLLEVPNMAANSHDSKHKPISKNIQRLLEKSEKQAFTAPPENVRVHVIAATRALIKGNFQE
AFSVLNSLDIWRLFKNRDSILDMVKASISEVALRTYLFTYSSSCYKSLSLAELAKMFDISESHVYSIVSKMMINKELNAT
WDQPTQCIVFHEVQHNRAQSLAFQITEKLATLAESNESAMESKTGGVGLDMTSRRRENSQDYAAAASDNRGLKMDGSSLT
RGVSA*

DNA
ATGACGACGACTTCTCGTTTTTTCGCTCAGAGTGGAAGTGAAAGTGAAGATGAGAGTGACTTTGAAAAAGAAGAGGTTGA
GGGTAACAACACTCGTTACCTTGCAGACTTACCTGACGGTGAGATTTGTTGTGGTATGGATACTAAACGTGTGGTTAAGC
CAAAAAAAGATAAACGTTTTGAGGAGATGGCCAACACTATAGAGAATATGAAGCATGCCATGAACATCAATGATTGTGTT
TACTTGCAAGAAACGTTTGAGAAACTCAACAAACAGATTAGTAAGTCCGTAAAGACTCCGACTTTGTATATCAAGACCCT
TGTGATGTTGGAAGATTTCTTGAATGAAGATAATATGAAAACAAAGGAGAAGATGAGTACTAGTAACTCCAAGGCTTTGA
ACGCAATGAGACAGAAACTGAAGAAGAACAATCTGCAGTACCAAGAAGATATCAAAAGATTTAGGGAGTCTCCAGAAATC
GAAGACGATGATGAGTATGAAGAGGAGGTGGTGGAGGATTCTGCTGATAATGTTTCTTGGGAGATGTTGTTTAGTTTAGA
TCATGAAGAGATAACTTGGAACATGGTCAACAAGAAGTTCAAAGAAATTAGGGCTGCTCGTTGGAGCAAAAGAAGAAGTT
CTAGCCTTAAACTCAAACCCGGCGAGACTCATGCGCAGAAGCATATGGACTTGACAAAGATCGCCAAGACTCCTGCACAG
AAGGTTGAAATCTTGTTTAGTGTTATTTCAGCAGAGTTTAATGTGAATTCTGGTGGTCTCAGCGGATACATGCCTATCGA
TGTCTGGAAGAAATGTGTGGTTAACATGCTTACCATACTTGACATTCTTGTCAAGTACTATAACATTGTTGTGGATGATA
CCGTTGAACCTGATGAGAAGGAAACTTCAAAGCCAGCGGCATACGATGGAACCATTCGGGTCTCGGGAAATTTGGTTGCA
TTCTTAGAGAAGATTGAGACAGAGTTTTTCAAGAGTTTGCAGTGCATTGATCCTCACACCAATGATTATGTTGAGAGGTT
GAAAGATGAGCCTATGTTCTTGGCTCTTGCTCAGAGTATCCAAGACTACTTGGAGCGGACAGGCGATTCTAAAGCTGCTT
CAAAGGTAGCCTTTATACTAGTCGAGTCAATCTATTACAAGCCTCAAGAAGTTTTTGATGCTATGAGTAAATTGGCTGAT
GAGGAAATTGAGGAGGCTAACGAGGAAAGTGGATCTTCTTCTTCTTCATTCATTGTTGTTGCGGAGATTGTTCCTCGTAA
GCCTACCTTCGCAAAGAGCAGCAGAGCTATGATGGATACACTTGTATCCTTTATCTACAAAAATGGAGATGAGAGGACCA
AAGCCAGAGCAATGCTATGTGATATCTATCAACATGCTTTAATGGACAATTTTGTTACTGCTAGAGACTTGTTGCTGATG
AGTCATCTACAAGAAAACATTCAACACATGGACATCTCTACACAGATTCTCTTTAACAGGACAATGGCACAACTTGGTCT
TTGCGCTTTTCGGGTTGGAATGATAACTGAGTCACATAGCTGTCTCTCTGAGCTGTACTCTGGGAATAGAGTTAGGGAGT
TGCTTGGTCAAGGTGTCTCGCAAAGTCGAGACCACGAGAAGACAACAGAGCAGATGCTTATGGAGAGGAGAACACAAATA
CCGTACCATATGAACATAAACCTCGAGCTCTTGGAGGCTGTTTATCTTACTTGTGCCATGCTACTTGAAGTCCCAAACAT
GGCAGCAAACTCGCATGATTCCAAACACAAACCGATTAGCAAGAATATTCAGCGCCTGCTCGAGAAAAGTGAGAAGCAAG
CGTTCACTGCACCCCCTGAAAATGTACGTGTCCATGTCATTGCAGCCACCAGAGCCCTGATCAAAGGAAACTTCCAAGAA
GCGTTTTCAGTTTTGAACTCTCTTGATATCTGGAGACTGTTCAAGAACCGCGACAGCATACTCGATATGGTGAAAGCTAG
TATCAGTGAAGTGGCTCTAAGGACTTATTTATTCACATACTCGAGCTCCTGTTACAAGTCCTTAAGTCTAGCTGAGCTAG
CCAAAATGTTTGACATCTCTGAGTCACACGTCTATAGTATTGTGAGCAAGATGATGATCAACAAGGAGCTTAATGCAACA
TGGGACCAGCCAACTCAATGCATCGTCTTCCATGAAGTGCAACATAACAGAGCACAATCCTTGGCTTTTCAGATTACCGA
AAAACTCGCGACTCTAGCAGAAAGCAACGAAAGTGCAATGGAGTCTAAAACTGGTGGTGTTGGCCTTGATATGACTTCAA
GGAGAAGGGAAAACAGTCAGGACTATGCAGCAGCAGCATCAGACAACAGAGGTCTGAAAATGGATGGCTCAAGTCTTACC
CGAGGCGTTTCTGCGTAA