Details for Arabidopsis Locus AT3G22850

Position : Chr3 ( 5`- 8089003 .. 8090470 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22850

Protein [Map View]
MLAIFDKNVAKTPEALQGQEGGSVCALKDRFLPNHFSSVYPGAVTINLGSSGFIACSLEKQNPLLPRLFAVVDDMFCIFQ
GHIENVPILKQQYGLTKTATEVTIVIEAYRTLRDRGPYSAEQVVRDFQGKFGFMLYDCSTQNVFLAGDVDGSVPLYWGTD
AEGHLVVSDDVETVKKGCGKSFAPFPKGCFFTSSGGLRSYEHPSNELKPVPRVDSSGEVCGVTFKVDSEAKKEAMPRVGS
VQNWSKQI*

DNA
ATGTTGGCGATTTTCGACAAGAACGTGGCGAAAACACCCGAGGCTCTTCAGGGTCAAGAGGGTGGATCGGTTTGTGCTCT
TAAAGATAGGTTCTTGCCGAACCATTTCTCCTCTGTTTATCCTGGTGCTGTCACCATCAATCTCGGATCTTCTGGTTTCA
TTGCTTGCTCTCTCGAGAAACAGAACCCTCTTCTTCCCAGATTGTTTGCTGTGGTGGATGATATGTTCTGCATATTCCAA
GGACATATAGAGAACGTTCCAATTCTTAAGCAACAATATGGACTAACCAAAACAGCTACAGAGGTTACCATTGTGATTGA
AGCCTACAGAACTCTAAGAGATCGTGGTCCGTATTCAGCTGAACAAGTTGTTAGAGATTTTCAAGGCAAATTCGGGTTTA
TGCTCTATGACTGCTCCACACAAAATGTCTTCCTTGCCGGGGATGTAGATGGGAGTGTTCCTCTCTACTGGGGAACCGAT
GCTGAAGGACATCTTGTTGTTTCTGATGATGTTGAGACTGTCAAGAAGGGTTGTGGTAAATCCTTTGCGCCATTCCCTAA
AGGATGTTTCTTTACCTCATCTGGAGGTTTGAGGAGCTATGAGCATCCATCAAATGAGTTAAAGCCGGTACCAAGGGTAG
ACAGTTCGGGTGAGGTTTGCGGTGTAACGTTTAAAGTGGATTCTGAGGCCAAGAAAGAAGCGATGCCTAGGGTTGGGAGT
GTTCAGAATTGGTCTAAACAAATCTGA