Details for Arabidopsis Locus AT3G22830

Position : Chr3 ( 5`- 8078820 .. 8081051 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22830

Protein [Map View]
MDPSFRFIKEEFPAGFSDSPSPPSSSSYLYSSSMAEAAINDPTTLSYPQPLEGLHESGPPPFLTKTYDLVEDSRTNHVVS
WSKSNNSFIVWDPQAFSVTLLPRFFKHNNFSSFVRQLNTYGFRKVNPDRWEFANEGFLRGQKHLLKNIRRRKTSNNSNQM
QQPQSSEQQSLDNFCIEVGRYGLDGEMDSLRRDKQVLMMELVRLRQQQQSTKMYLTLIEEKLKKTESKQKQMMSFLARAM
QNPDFIQQLVEQKEKRKEIEEAISKKRQRPIDQGKRNVEDYGDESGYGNDVAASSSALIGMSQEYTYGNMSEFEMSELDK
LAMHIQGLGDNSSAREEVLNVEKGNDEEEVEDQQQGYHKENNEIYGEGFWEDLLNEGQNFDFEGDQENVDVLIQQLGYLG
SSSHTN*

DNA
ATGGATCCTTCATTTAGGTTCATTAAAGAGGAGTTTCCTGCTGGATTCAGTGATTCTCCATCACCACCATCTTCTTCTTC
ATACCTTTATTCATCTTCCATGGCTGAAGCAGCCATAAATGATCCAACAACATTGAGCTATCCACAACCATTAGAAGGTC
TCCATGAATCAGGGCCACCTCCATTTTTGACAAAGACATATGACTTGGTGGAAGATTCAAGAACCAATCATGTCGTGTCT
TGGAGCAAATCCAATAACAGCTTCATTGTCTGGGATCCACAGGCCTTTTCTGTAACTCTCCTTCCCAGATTCTTCAAGCA
CAATAACTTCTCCAGTTTTGTCCGCCAGCTCAACACATATGGTTTCAGAAAGGTGAATCCGGATCGGTGGGAGTTTGCAA
ACGAAGGGTTTCTTAGAGGGCAAAAGCATCTCCTCAAGAACATAAGGAGAAGAAAAACAAGTAATAATAGTAATCAAATG
CAACAACCTCAAAGTTCTGAACAACAATCTCTAGACAATTTTTGCATAGAAGTGGGTAGGTACGGTCTAGATGGAGAGAT
GGACAGCCTAAGGCGAGACAAGCAAGTGTTGATGATGGAGCTAGTGAGACTAAGACAGCAACAACAAAGCACCAAAATGT
ATCTCACATTGATTGAAGAGAAGCTCAAGAAGACCGAGTCAAAACAAAAACAAATGATGAGCTTCCTTGCCCGCGCAATG
CAGAATCCAGATTTTATTCAGCAGCTAGTAGAGCAGAAGGAAAAGAGGAAAGAGATCGAAGAGGCGATCAGCAAGAAGAG
ACAAAGACCGATCGATCAAGGAAAAAGAAATGTGGAAGATTATGGTGATGAAAGTGGTTATGGGAATGATGTTGCAGCCT
CATCCTCAGCATTGATTGGTATGAGTCAGGAATATACATATGGAAACATGTCTGAATTCGAGATGTCGGAGTTGGACAAA
CTTGCTATGCACATTCAAGGACTTGGAGATAATTCCAGTGCTAGGGAAGAAGTCTTGAATGTGGAAAAAGGAAATGATGA
GGAAGAAGTAGAAGATCAACAACAAGGGTACCATAAGGAGAACAATGAGATTTATGGTGAAGGTTTTTGGGAAGATTTGT
TAAATGAAGGTCAAAATTTTGATTTTGAAGGAGATCAAGAAAATGTTGATGTGTTAATTCAGCAACTTGGTTATTTGGGT
TCTAGTTCACACACTAATTAA