Details for Arabidopsis Locus AT3G22800

Position : Chr3 ( 5`- 8062888 .. 8064556 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22800

Protein [Map View]
MREDTFFFQWWFLVSGLSFIFLLPQAFTYHTPPINPCFAHPFLPPITNPRLLKAFTALQAWKFTITSDPNGFTSNWCGPN
VCNYTGVFCAPALDNPYVLTVAGIDLNHANIAGYLPLELGLLTDLALFHINSNRFQGQLPKTLKCLHLLHELDVSNNKLS
GEFPSVIFSLPSLKFLDIRFNEFQGDVPSQLFDLNLDALFINDNKFQFRLPRNIGNSPVSVLVLANNDLQGSCVPPSFYK
MGKTLHEIIITNSQLTGCLNREIGLLNQLTVFDVSYNNLVGSLPETIGDMKSLEQLNIAHNKFSGYIPESICRLPRLENF
TYSYNFFSGEPPACLRLQEFDDRRNCLPSRPMQRSLAECKSFSSYPIDCASFGCSPPSPPPPPPPPPPPPPPPPPPPPPP
PPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMYPSPPCNDLPTPVHY*

DNA
ATGAGAGAAGACACCTTCTTCTTCCAGTGGTGGTTCTTGGTCTCTGGTCTCAGCTTCATCTTCCTTCTTCCTCAAGCTTT
CACCTACCATACTCCTCCAATAAACCCGTGCTTCGCTCATCCTTTTCTTCCTCCTATCACAAACCCGAGGCTCTTAAAAG
CTTTCACAGCTCTTCAAGCTTGGAAGTTCACCATAACCTCTGACCCAAACGGCTTCACTTCTAACTGGTGCGGTCCTAAT
GTTTGTAACTACACAGGCGTGTTTTGTGCACCGGCTCTAGATAACCCTTATGTCTTAACCGTCGCTGGTATAGACTTGAA
CCATGCTAATATCGCCGGTTATCTCCCTTTAGAGCTTGGTCTCTTAACCGATCTTGCCTTGTTCCATATCAATTCCAACC
GTTTTCAAGGTCAACTTCCCAAAACTCTAAAATGTCTCCATCTTCTCCATGAGCTTGACGTCAGCAACAATAAACTCTCC
GGCGAGTTTCCTTCCGTAATCTTCTCTTTGCCTTCCTTGAAGTTTCTCGACATTAGGTTCAATGAGTTCCAAGGTGATGT
TCCTAGCCAACTCTTTGACCTAAACCTCGACGCTCTCTTCATTAACGACAACAAATTCCAGTTTAGGTTACCGAGAAACA
TCGGAAACTCTCCGGTTTCTGTTCTTGTCTTGGCCAACAACGATCTCCAAGGATCTTGTGTACCTCCAAGTTTCTACAAA
ATGGGGAAAACATTACACGAAATCATTATCACGAACTCACAACTAACCGGTTGTTTAAACCGGGAAATCGGTTTGCTTAA
CCAGTTGACGGTTTTCGACGTGAGTTACAACAACTTGGTGGGTTCGTTGCCGGAGACTATAGGTGATATGAAGAGTTTAG
AGCAGTTAAACATTGCGCATAACAAATTCTCCGGCTACATTCCGGAGAGTATCTGCCGATTACCAAGGCTCGAGAACTTC
ACTTACTCGTATAACTTCTTCTCCGGTGAGCCACCGGCTTGTTTGAGGCTTCAAGAGTTTGATGATCGTAGAAATTGTTT
ACCTTCAAGGCCAATGCAACGGTCTCTCGCTGAATGCAAATCCTTTTCTTCTTATCCTATTGATTGTGCATCCTTTGGCT
GCTCTCCACCTAGTCCACCGCCTCCTCCTCCTCCTCCTCCACCTCCACCTCCACCTCCACCTCCACCTCCACCTCCACCT
CCACCTCCACCACCGCCACCATATGTGTATCCTTCGCCGCCGCCACCACCTCCATCACCTCCACCATACGTGTATCCACC
GCCACCGCCACCATATGTGTATCCTCCACCGCCATCACCACCATATGTGTATCCTCCGCCACCACCGTCACCGCAACCAT
ATATGTATCCTTCACCTCCTTGTAACGATCTTCCAACGCCGGTGCATTACTAA