Details for Arabidopsis Locus AT3G22760

Position : Chr3 ( 5`- 8044455 .. 8047530 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22760

Protein [Map View]
MDTPEKSETQIGTPVSKLKVEDSPVFSYICNLSPIKTIKPIPITCPLSSLNYASPPSVFTSPHAVSHKESRFRSQKDVSA
SKEVGEEEALVGSEPEQSYKNDCNTPRVTNDVKDNGCGKDLQVMMDNVKKKSDTPDWETLIAATTELIYGSPRESEAFSC
LLKKTSNSEARLRGSITATSVAVTNTDVVNNESESVDALSILHRGVRRRCLDFEVKGNNQQTLGESSSSCVVPSIGLHLN
TIAMSSKDKNVANEYSFSGNIKVGVQSSLTPVLHSQHDIVRENESGKDSGQIIEVVPKSLASVDLTPISPKKKRRKSEQS
GEGDSSCKRCNCKKSKCLKLYCECFAAGFYCIEPCSCINCFNKPIHKDVVLATRKQIESRNPLAFAPKVIRNSDSIIEVG
EDASKTPASARHKRGCNCKKSNCLKKYCECYQGGVGCSINCRCEGCKNAFGRKDGSLFEQDEENETSGTPGTKKTQQNVE
LFKPAAPPSTPIPFRQPLAQLPISSNNRLLPPQSHFHHGAIGSSSSGIYNIRKPDMSLLSHSRIETITEDIDDMSENLIH
SPITTLSPNSKRVSLSHLDSPESTPWRRNGGGRNLIRSFPTFPSLTPHH*

DNA
ATGGATACACCGGAAAAGAGTGAAACCCAGATCGGTACTCCAGTTTCTAAACTCAAAGTCGAGGATTCACCAGTGTTTAG
TTACATATGCAATCTCTCACCAATTAAGACTATCAAACCAATTCCAATCACTTGTCCTTTAAGCTCTCTCAATTACGCAT
CTCCACCTTCTGTTTTCACTTCTCCTCACGCGGTTTCTCATAAAGAGTCTCGTTTCAGAAGTCAAAAAGATGTGTCTGCT
TCTAAAGAAGTTGGAGAAGAAGAAGCTTTAGTCGGTAGCGAACCGGAACAAAGCTACAAGAATGACTGCAATACTCCTAG
AGTTACCAATGATGTGAAAGACAATGGTTGTGGGAAGGATTTGCAGGTGATGATGGACAATGTCAAGAAGAAAAGTGATA
CTCCGGATTGGGAAACTTTGATTGCTGCTACAACAGAACTGATTTATGGCTCACCGAGAGAGTCAGAGGCTTTTAGTTGC
TTGTTGAAGAAAACTTCAAACTCTGAAGCACGTCTACGTGGTAGTATAACTGCAACATCGGTGGCTGTTACGAATACCGA
TGTAGTCAACAATGAATCTGAATCTGTTGATGCTCTTTCGATATTGCACCGTGGTGTGAGAAGACGGTGTTTAGACTTTG
AGGTTAAGGGGAATAATCAGCAAACATTAGGAGAATCTTCATCTAGTTGTGTAGTACCTAGCATTGGTCTGCATCTTAAC
ACCATTGCAATGTCCTCTAAGGACAAGAATGTTGCTAATGAGTATTCATTTTCCGGTAACATAAAAGTCGGTGTGCAAAG
TTCTCTGACTCCGGTGCTTCATTCGCAGCACGACATCGTGAGAGAAAATGAAAGCGGGAAAGATTCAGGACAAATTATAG
AAGTGGTTCCAAAGTCTTTAGCTTCAGTAGACTTGACTCCAATAAGCCCCAAGAAGAAAAGGCGTAAGTCCGAACAATCA
GGAGAAGGCGACTCGTCATGTAAACGGTGCAACTGCAAAAAATCCAAGTGTTTGAAGCTTTACTGTGAATGCTTTGCTGC
TGGATTTTATTGCATAGAGCCATGTTCATGTATAAATTGCTTCAACAAACCTATCCATAAAGATGTTGTCCTGGCTACTC
GCAAACAGATTGAATCCCGCAATCCACTTGCATTTGCTCCTAAAGTCATCAGAAACTCAGATTCCATCATTGAAGTTGGT
GAGGATGCAAGTAAAACTCCAGCTTCAGCGCGACACAAACGAGGCTGTAACTGCAAGAAATCAAACTGTCTGAAGAAATA
CTGTGAATGCTATCAGGGCGGAGTTGGTTGTTCTATAAACTGTAGATGTGAAGGATGTAAAAATGCATTTGGCAGAAAAG
ATGGGTCTTTGTTCGAACAAGATGAGGAGAATGAAACATCTGGCACACCCGGAACAAAGAAAACACAACAGAATGTCGAG
TTGTTCAAACCTGCAGCTCCACCTTCAACACCAATTCCATTTAGACAACCACTGGCGCAACTTCCAATCTCATCCAACAA
CAGACTGCTACCTCCACAGTCTCATTTTCATCATGGAGCTATTGGATCATCTTCCTCAGGGATATACAACATCAGAAAAC
CAGACATGAGTTTGTTGTCTCATTCAAGAATCGAGACAATCACAGAGGATATTGATGATATGTCTGAGAATCTAATCCAT
TCTCCAATAACTACTCTATCTCCCAACAGCAAAAGGGTTTCGTTGTCTCATCTTGATTCACCAGAGTCGACTCCATGGAG
AAGAAATGGTGGGGGGAGGAATCTGATACGTTCGTTCCCAACGTTTCCTTCTCTCACTCCACACCATTAA