Details for Arabidopsis Locus AT3G22740

Position : Chr3 ( 5`- 8032959 .. 8035809 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22740

Protein [Map View]
MGSFVKEETSSLMTDFLEKCGGYAVVDGGFATELQRHGADINDPLWSAKCLITSPHLVTKVHLDYLESGANIIITASYQA
TIQGFVAKGLSVGEAENLLRRSVEITYEAREIFYNRCTKGSWDFAYAGKASRRPILVAASVGSYGAYLADGSEYSGIYGD
SVSKETLKDFHRRRVQILAKSGADLIAFETIPNKLEAEAYADLLEEEDIDIPAWFSFTSKDGVSVPRGDSVVECAKVADS
CKNVVAIGINCTAPRYIHALIISLRQMTRKPIVVYPNSGEVYDGLNKKWIKSEGESEEDFVSYVSKWRDAGASLFGGCCR
TTPNTIRAIAKVLSDEPSAASKPKFGQ*

DNA
ATGGGATCTTTCGTGAAAGAAGAAACGTCGTCGTTGATGACAGATTTTTTGGAGAAGTGCGGTGGTTATGCGGTGGTGGA
TGGAGGGTTTGCGACGGAGCTACAGCGCCACGGAGCTGATATCAATGATCCACTTTGGAGTGCTAAGTGCCTTATTACTT
CTCCTCACCTTGTTACAAAGGTGCACTTGGATTACCTTGAATCTGGAGCAAATATCATCATAACAGCATCTTACCAGGCG
ACGATACAAGGTTTTGTGGCAAAAGGTCTATCGGTGGGAGAAGCAGAAAATTTACTTAGAAGGAGCGTTGAAATCACGTA
CGAGGCACGTGAGATTTTCTACAACAGATGCACCAAGGGTTCATGGGATTTCGCCTACGCTGGAAAAGCTTCCCGGAGAC
CAATTCTTGTCGCAGCTTCCGTTGGTAGCTATGGAGCTTATCTCGCTGACGGCTCCGAATACAGTGGGATATATGGAGAT
TCTGTGAGTAAGGAGACATTAAAGGATTTCCATAGAAGAAGAGTTCAAATCTTAGCAAAATCTGGAGCCGACCTAATAGC
ATTCGAGACTATTCCAAATAAGCTCGAAGCAGAGGCTTATGCGGATCTTCTTGAGGAGGAAGATATCGATATTCCGGCAT
GGTTCTCGTTCACTTCCAAGGACGGAGTCAGTGTGCCACGAGGAGATTCAGTTGTAGAATGTGCGAAAGTGGCAGATTCA
TGCAAGAACGTGGTGGCCATTGGAATCAATTGTACTGCACCAAGATACATTCATGCTTTAATTATCTCCTTGCGCCAGAT
GACACGCAAACCAATCGTTGTATACCCAAACAGCGGGGAAGTCTACGACGGTCTGAACAAGAAATGGATTAAGTCAGAGG
GAGAGTCAGAGGAGGATTTTGTGTCGTACGTGAGTAAATGGAGAGATGCAGGAGCTTCTCTGTTTGGAGGATGTTGTCGG
ACTACTCCAAACACCATCAGAGCCATTGCTAAAGTTCTCTCCGACGAACCTTCTGCAGCATCAAAACCCAAATTCGGGCA
ATAG