Details for Arabidopsis Locus AT3G22680

Position : Chr3 ( 5`- 8019708 .. 8020508 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22680

Protein [Map View]
MQSSMTMELRPSGDSGSSDVDAEISDGFSPLDTSHRDVADEGSLLRRAEMYQDYMKQVPIPTNRGSLIPFTSWVGLSISM
KQLYGQPLHYLTNVLLQRWDQSRFGTDSEEQRLDSIIHPTKAEATIWLVEEIHRLTPSHLHMALLWRSDPMYHSFIDPIF
PEK*

DNA
ATGCAAAGCTCAATGACAATGGAACTACGACCATCAGGTGATTCCGGTTCATCTGACGTCGATGCTGAGATCAGCGATGG
CTTTTCACCGCTCGATACTTCTCACAGAGACGTCGCTGATGAAGGTTCGTTGCTGAGAAGAGCAGAGATGTATCAAGACT
ACATGAAGCAAGTACCAATCCCGACGAATCGTGGCTCGTTGATTCCGTTCACAAGCTGGGTTGGATTAAGCATTTCAATG
AAACAGCTTTATGGTCAGCCTCTACATTACCTCACGAATGTTCTCTTACAACGATGGGATCAATCACGATTCGGTACTGA
TTCTGAAGAACAGAGGTTGGATTCTATCATTCATCCTACTAAAGCTGAAGCTACTATCTGGCTTGTTGAAGAGATTCATC
GACTCACTCCTTCTCATCTTCACATGGCTCTTCTTTGGAGATCTGATCCTATGTATCACTCTTTCATTGACCCAATCTTT
CCTGAGAAATGA