Details for Arabidopsis Locus AT3G22670

Position : Chr3 ( 5`- 8017771 .. 8019459 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22670

Protein [Map View]
MLTKLRISKLVSYTLPRRIFQRRFLVTNNTAEESPIVAAESPELPSWIKDFLSNKPSSSSSSVSKDDEDFVIPSLANWVE
SQKFSRQQVSEGNVVKKPVEDIDKVCDFLNKKDTSHEDVVKELSKCDVVVTESLVLQVLRRFSNGWNQAYGFFIWANSQT
GYVHSGHTYNAMVDVLGKCRNFDLMWELVNEMNKNEESKLVTLDTMSKVMRRLAKSGKYNKAVDAFLEMEKSYGVKTDTI
AMNSLMDALVKENSIEHAHEVFLKLFDTIKPDARTFNILIHGFCKARKFDDARAMMDLMKVTEFTPDVVTYTSFVEAYCK
EGDFRRVNEMLEEMRENGCNPNVVTYTIVMHSLGKSKQVAEALGVYEKMKEDGCVPDAKFYSSLIHILSKTGRFKDAAEI
FEDMTNQGVRRDVLVYNTMISAALHHSRDEMALRLLKRMEDEEGESCSPNVETYAPLLKMCCHKKKMKLLGILLHHMVKN
DVSIDVSTYILLIRGLCMSGKVEEACLFFEEAVRKGMVPRDSTCKMLVDELEKKNMAEAKLKIQSLVQSKTMIDSHSPLS
VS*

DNA
ATGCTCACTAAGCTTAGGATTAGTAAGCTTGTTTCGTATACTTTACCTCGGAGAATCTTCCAACGGAGGTTTCTGGTAAC
GAATAACACTGCAGAGGAGTCGCCGATTGTTGCCGCAGAGTCACCGGAGCTACCGTCTTGGATTAAAGACTTTCTATCAA
ACAAGCCTTCTTCTTCATCGAGTTCGGTTTCCAAAGATGATGAAGATTTTGTTATCCCTTCTTTGGCGAATTGGGTCGAG
AGCCAGAAGTTTAGTCGTCAACAAGTCTCAGAGGGAAATGTAGTGAAGAAACCAGTGGAAGATATTGATAAAGTTTGCGA
CTTTTTGAATAAGAAGGACACGTCTCATGAGGATGTTGTTAAAGAGTTGAGTAAATGCGATGTGGTGGTTACAGAGAGTT
TGGTTTTGCAAGTTCTAAGAAGGTTTAGTAATGGTTGGAATCAAGCTTACGGGTTTTTCATTTGGGCAAATTCACAAACA
GGTTATGTGCATTCAGGTCATACTTATAATGCAATGGTTGATGTGTTGGGGAAATGTAGGAATTTTGATTTGATGTGGGA
ATTAGTCAATGAGATGAACAAGAATGAAGAATCTAAGCTTGTTACGCTTGATACGATGAGTAAGGTTATGAGGAGATTGG
CCAAGTCAGGGAAATATAATAAAGCTGTTGATGCTTTTTTAGAGATGGAGAAGAGTTATGGTGTGAAAACAGATACTATT
GCTATGAACAGTTTGATGGATGCACTTGTGAAAGAGAATAGTATAGAGCATGCTCATGAAGTTTTTCTGAAGCTTTTCGA
TACAATCAAGCCGGATGCGCGGACATTCAACATTTTGATTCACGGTTTTTGTAAAGCTCGGAAATTTGATGATGCTAGAG
CGATGATGGATTTGATGAAGGTTACTGAGTTCACTCCTGATGTTGTTACTTACACTAGCTTTGTGGAAGCTTATTGCAAG
GAAGGGGATTTTAGGAGGGTTAATGAAATGTTGGAAGAGATGCGAGAGAATGGGTGTAATCCTAATGTTGTGACTTATAC
TATTGTGATGCATTCTTTGGGTAAATCTAAACAAGTAGCTGAAGCTTTAGGAGTGTATGAGAAGATGAAAGAAGATGGTT
GTGTTCCTGATGCTAAGTTTTATAGCTCATTGATACATATTTTGTCGAAGACTGGTAGGTTTAAGGATGCAGCTGAGATA
TTTGAGGACATGACGAATCAAGGAGTTCGTCGTGATGTTTTAGTCTACAATACCATGATTTCCGCTGCGCTTCATCACTC
ACGAGATGAGATGGCTCTACGTTTGCTTAAAAGGATGGAGGATGAGGAGGGGGAATCATGTAGTCCAAACGTTGAGACTT
ATGCTCCATTGTTGAAGATGTGTTGCCATAAGAAGAAAATGAAGCTACTTGGAATATTATTGCATCACATGGTGAAAAAC
GATGTTAGTATCGATGTTTCGACATATATTCTTCTCATTAGAGGGTTATGTATGAGCGGGAAAGTTGAAGAAGCTTGCTT
GTTCTTTGAGGAAGCAGTACGAAAAGGAATGGTTCCTAGAGATAGCACTTGCAAAATGTTGGTAGATGAGCTTGAGAAGA
AAAATATGGCAGAAGCAAAACTCAAGATTCAGAGTTTGGTTCAATCGAAAACAATGATTGATTCTCACAGTCCTTTATCT
GTTTCGTAG