Details for Arabidopsis Locus AT3G22640

Position : Chr3 ( 5`- 8011724 .. 8013902 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22640

Protein [Map View]
MAITNKLIITLLLLISIAVVHCLSFRVEIDEFEPPQQGEQEGPRRRPGGGSGEGWEEESTNHPYHFRKRSFSDWFQSKEG
FVRVLPKFTKHAPALFRGIENYRFSLVEMEPTTFFVPHHLDADAVFIVLQGKGVIEFVTDKTKESFHITKGDVVRIPSGV
TNFITNTNQTVPLRLAQITVPVNNPGNYKDYFPAASQFQQSYFNGFTKEVLSTSFNVPEELLGRLVTRSKEIGQGIIRRI
SPDQIKELAEHATSPSNKHKAKKEKEEDKDLRTLWTPFNLFAIDPIYSNDFGHFHEAHPKNYNQLQDLHIAAAWANMTQG
SLFLPHFNSKTTFVTFVENGCARFEMATPYKFQRGQQQWPGQGQEEEEDMSENVHKVVSRVCKGEVFIVPAGHPFTILSQ
DQDFIAVGFGIYATNSKRTFLAGEENLLSNLNPAATRVTFGVGSKVAEKLFTSQNYSYFAPTSRSQQQIPEKHKPSFQSI
LDFAGF*

DNA
ATGGCAATAACCAACAAATTAATCATAACACTTCTTCTCCTTATCTCCATAGCTGTCGTCCACTGCTTATCCTTCCGTGT
GGAGATCGACGAGTTCGAGCCACCACAGCAAGGAGAACAAGAAGGTCCCCGTCGCCGTCCTGGTGGTGGCTCTGGCGAGG
GATGGGAGGAAGAGTCGACGAATCATCCATACCACTTCAGGAAGCGGAGTTTCAGTGATTGGTTCCAGTCAAAGGAAGGT
TTTGTGAGAGTGCTGCCTAAGTTCACAAAACATGCACCGGCTCTCTTCCGAGGAATCGAGAACTACAGATTCTCGTTGGT
GGAGATGGAGCCAACAACTTTCTTTGTGCCTCACCATTTGGATGCCGATGCTGTTTTTATAGTCCTACAAGGTAAAGGAG
TGATCGAGTTTGTGACGGATAAAACAAAAGAATCGTTCCACATAACTAAAGGTGATGTGGTAAGAATCCCTTCTGGTGTC
ACCAACTTTATCACCAACACTAACCAGACGGTTCCTCTCCGCCTCGCCCAGATCACCGTCCCTGTCAACAATCCCGGCAA
CTACAAGGATTACTTCCCTGCTGCATCCCAATTTCAGCAATCCTACTTCAATGGGTTTACCAAAGAAGTCCTCTCTACCA
GTTTCAACGTGCCGGAAGAATTGCTAGGGAGATTGGTTACGAGATCAAAAGAAATTGGTCAAGGGATTATCCGAAGAATT
TCTCCAGACCAAATCAAGGAACTTGCTGAGCACGCTACATCTCCTTCAAACAAACACAAAGCCAAAAAAGAAAAGGAGGA
AGACAAAGACCTAAGAACGTTGTGGACTCCTTTCAATCTCTTTGCAATAGATCCAATCTACTCCAACGACTTTGGTCATT
TCCACGAGGCACATCCTAAGAATTATAATCAACTGCAAGACCTTCACATAGCCGCCGCTTGGGCTAACATGACACAGGGA
TCCTTGTTCCTTCCTCATTTTAACTCTAAGACCACATTTGTAACGTTTGTGGAGAATGGTTGTGCCCGCTTCGAGATGGC
TACTCCTTATAAATTCCAAAGAGGGCAACAACAATGGCCAGGACAAGGACAAGAAGAAGAAGAAGATATGAGTGAAAACG
TACACAAAGTTGTGTCACGAGTGTGTAAAGGCGAAGTTTTTATCGTTCCGGCAGGTCATCCATTCACTATACTCTCGCAA
GATCAAGACTTTATCGCGGTAGGGTTTGGTATTTATGCGACCAACAGCAAAAGAACGTTCCTTGCAGGGGAAGAGAATTT
GCTGAGCAACCTCAACCCGGCGGCAACTAGGGTAACCTTTGGTGTTGGAAGTAAAGTCGCGGAGAAACTGTTCACGAGCC
AAAACTATTCCTACTTTGCACCTACGAGTCGTAGCCAACAACAAATTCCAGAGAAACACAAGCCATCGTTTCAATCAATC
TTAGACTTTGCTGGTTTTTGA