Details for Arabidopsis Locus AT3G22630

Position : Chr3 ( 5`- 8009540 .. 8010844 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22630

Protein [Map View]
MECVFGLVGNGFAIVAADTSAVHSILLHKNNEDKIMVLDSHKLVAASGEPGDRVQFTEYVQKNVSLYKFRNGIPLTTAAA
ANFTRGELATALRKNPYSVNILMAGYDDESGASLYYIDYIATLHKVDKGAFGYGSYFSLSTMDRHYRSDMSVEEAIELVD
KCILEIRSRLVVAPPNFVIKIVDKDGARDYAWRQSVKDVTTAVV*

DNA
ATGGAGTGTGTATTCGGTCTTGTTGGGAATGGATTCGCCATCGTTGCTGCTGATACATCGGCGGTTCATAGTATCCTTCT
TCACAAAAACAACGAAGACAAGATCATGGTACTTGACTCACACAAGCTTGTTGCTGCTAGTGGCGAGCCTGGTGACCGGG
TTCAGTTTACGGAGTACGTTCAGAAGAATGTGTCCTTGTACAAATTCAGAAATGGAATCCCGTTGACTACCGCCGCTGCT
GCCAATTTCACTCGCGGAGAGCTCGCTACTGCTTTGAGGAAGAATCCGTATTCGGTGAATATCCTGATGGCTGGCTATGA
CGATGAGTCTGGTGCATCACTTTACTACATCGACTACATTGCAACTCTTCACAAAGTCGACAAGGGAGCTTTTGGTTACG
GCTCCTACTTCTCCCTCTCCACGATGGACAGGCATTACCGCAGTGACATGTCTGTAGAAGAAGCCATTGAACTAGTTGAC
AAATGCATACTTGAGATCCGGTCAAGACTCGTTGTTGCACCACCAAACTTTGTGATCAAGATTGTTGACAAAGATGGAGC
TCGTGATTACGCTTGGCGTCAGTCCGTAAAGGATGTCACAACTGCTGTTGTCTGA