Details for Arabidopsis Locus AT3G22590

Position : Chr3 ( 5`- 8003934 .. 8005579 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22590

Protein [Map View]
MDPLSVLKEFTIRGDIDKIERVGANYRFGSEYSFPCATETAYRSKSGSLYTLEALVHYVKNQQLKHGEYMQSTVKNSVPA
VTLPDRKPLLDYLTGRVASSDSIDFLLLQQQNAQSQKQNEEYRPDQDNSAFVSRENAIADMEVEDFGKSGEDVDYIMLIR
SNERPLKSRDAILQCKNRDFYSVLVNSTKREEERQRIESHQRKDGLVAKSRLMGAEERGIVGFSSGGGDDNGYDANPKSK
LHFKAGKIGEGVPIILVPSAFQTLITIYNVKEFLEDGVYIPNDVKAKEMKGLKPDCITVQKKFSRDRERVVTAYEVRDKP
SALKPDDWDRVVAVFVLGKDWQFKDWPFKDHVEIFNKIIGFFLRFEDDSIESAKTVKQWNVKIISISKNKRHQDRAAALE
VWEKLEEFVRSRSHS*

DNA
ATGGATCCATTATCAGTCCTGAAAGAATTCACAATCCGAGGAGACATTGATAAAATCGAGAGAGTTGGAGCTAATTACAG
ATTCGGATCGGAATATTCGTTTCCATGCGCGACGGAGACTGCGTACCGATCAAAAAGTGGAAGTCTCTACACACTAGAAG
CATTAGTACACTACGTGAAGAATCAACAACTGAAACATGGAGAGTATATGCAATCAACAGTCAAAAACTCAGTCCCGGCG
GTTACTTTACCAGATCGGAAACCTCTCCTCGATTACCTCACCGGAAGAGTCGCTTCTTCAGATTCTATTGATTTCCTCTT
GCTTCAACAGCAAAACGCACAGAGTCAGAAGCAGAACGAAGAGTATCGACCAGATCAAGACAATTCAGCTTTTGTATCGC
GCGAAAACGCGATTGCAGATATGGAGGTTGAAGATTTCGGTAAATCCGGTGAAGATGTTGATTACATTATGCTGATTCGA
TCCAACGAACGTCCATTGAAGAGCCGTGACGCGATTCTTCAGTGTAAGAATCGAGATTTCTATAGTGTGCTGGTGAATTC
TACCAAGAGAGAAGAAGAGAGACAGAGGATTGAGTCTCATCAGAGGAAAGATGGATTAGTTGCTAAGAGTAGGTTAATGG
GAGCTGAAGAAAGAGGTATTGTAGGGTTTAGTAGTGGTGGTGGTGATGATAATGGTTATGATGCTAATCCTAAATCTAAG
CTTCATTTTAAAGCTGGGAAGATTGGTGAAGGTGTGCCGATTATTCTTGTCCCGAGTGCGTTTCAGACTTTGATTACTAT
ATATAACGTTAAAGAGTTTCTTGAAGATGGTGTTTATATACCTAATGATGTTAAGGCTAAGGAGATGAAGGGGTTGAAGC
CTGATTGTATTACGGTTCAGAAGAAGTTTAGTAGAGATAGGGAGAGAGTTGTGACTGCTTATGAAGTTAGGGATAAGCCT
TCTGCTTTGAAGCCTGATGATTGGGATCGTGTTGTTGCGGTTTTTGTATTGGGGAAGGATTGGCAGTTTAAAGATTGGCC
TTTTAAGGATCATGTTGAGATATTCAATAAGATTATTGGATTCTTCTTGCGGTTTGAAGATGATAGTATCGAATCAGCCA
AGACGGTGAAGCAGTGGAATGTAAAGATCATCTCGATTAGCAAGAATAAGCGGCATCAAGACCGAGCTGCTGCATTAGAA
GTCTGGGAAAAACTCGAGGAGTTTGTGCGATCTCGGTCGCATTCTTAG