Details for Arabidopsis Locus AT3G22570

Position : Chr3 ( 5`- 8000515 .. 8001238 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22570

Protein [Map View]
MKIGVVLVLLTVFVVVMSSTSVSAQSDEDECLKETGQMQLNCFPYLTDNRIHTPSFACCSEVYTVGKTYVDCFCQFINNG
GPSFGIVVSQKLLDLPELCGVYGACGNGKNFKNTSL*

DNA
ATGAAGATAGGAGTGGTTTTAGTGTTGCTTACAGTTTTCGTGGTTGTGATGTCTTCTACAAGCGTCTCTGCTCAGTCGGA
CGAGGACGAGTGCTTGAAAGAGACAGGGCAGATGCAGTTGAATTGTTTCCCCTACCTAACTGATAATCGTATCCATACTC
CTAGTTTCGCGTGTTGTTCTGAGGTGTATACAGTAGGCAAGACATATGTTGACTGCTTTTGTCAATTCATCAACAATGGA
GGCCCTAGCTTCGGTATCGTTGTTTCCCAAAAACTTCTTGATCTGCCAGAGCTTTGTGGCGTTTATGGTGCCTGTGGCAA
CGGTAAGAATTTCAAAAACACTAGTTTATGA