Details for Arabidopsis Locus AT3G22560

Position : Chr3 ( 5`- 7998857 .. 7999533 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22560

Protein [Map View]
MIMESPRIFLRPFNLSDAEDVFKWAGDDDVTRYLRWDSVNSLEEAKQHILNKAIPHPWRRSISLLQDGHSIGYVSVKPDS
GDGRCRADLAYAVAKEFWGRGIATAAVRMAVEQALEDFPEVVRLQAVVEVENKASQRVLEKAGFRKEGLLEKYGFSKGVI
RDMFLYSYVKDDCFV*

DNA
ATGATCATGGAATCACCAAGAATCTTCCTCCGGCCGTTCAATCTCTCCGATGCAGAAGACGTCTTTAAATGGGCCGGTGA
CGATGACGTCACACGTTACCTCCGTTGGGACTCCGTTAACTCCTTAGAAGAAGCTAAACAACACATCTTAAACAAGGCTA
TACCACACCCATGGCGCCGTTCCATCTCTCTCCTCCAAGACGGTCATTCGATTGGTTACGTATCCGTCAAGCCAGACTCC
GGTGATGGTCGGTGCCGAGCCGACCTCGCATACGCTGTCGCTAAAGAGTTTTGGGGGCGGGGGATAGCCACAGCGGCGGT
GAGGATGGCGGTTGAACAAGCTTTGGAGGATTTTCCGGAGGTGGTGAGGCTACAAGCGGTGGTGGAGGTGGAGAACAAAG
CGTCCCAAAGGGTTTTGGAGAAAGCTGGATTTCGAAAAGAGGGTTTACTTGAGAAGTATGGTTTTAGCAAAGGAGTCATC
AGAGACATGTTTCTCTATAGTTACGTTAAAGATGATTGTTTTGTGTGA