Details for Arabidopsis Locus AT3G22550

Position : Chr3 ( 5`- 7991646 .. 7993454 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22550

Protein [Map View]
MLKKRSRSKQALMAETNQSQNQKQSKTTPFPRLFTAFSSFKSFTENDAVASPTSILDTKPFSVLKNPFGSDNPKTQEPET
RLKLEPKRIGLAIVDSLIQDETPEPGPRSGTILFGSQLRIRVPDSPISSSDFGIKTRNSQPETKKPGSESGLGSPRIISG
YFPASDMELSEDYTCVTCHGPNPRTIHIFDNCIVESQPGVVFFRSSDPVNESDSDYSPPDSFLSCCCNCKKSLGPRDDIF
MYRGDRAFCSSECRSIEMMMSEENDTK*

DNA
ATGCTAAAGAAGAGATCAAGAAGCAAGCAAGCTTTAATGGCGGAAACAAACCAGAGTCAGAATCAGAAACAGAGTAAAAC
GACGCCGTTTCCGAGGCTCTTCACAGCTTTTAGTAGCTTTAAAAGCTTCACTGAAAACGACGCCGTCGCGAGTCCAACTT
CAATTCTCGACACCAAACCTTTCTCTGTTTTGAAAAACCCATTTGGATCCGATAACCCGAAAACCCAAGAACCCGAAACC
CGTCTCAAACTCGAACCCAAAAGAATCGGACTCGCCATTGTCGATTCTCTAATCCAAGACGAAACACCCGAACCCGGACC
GAGATCCGGGACAATTCTATTCGGGTCTCAGCTTCGGATCCGGGTCCCGGATTCTCCGATTTCCTCGTCGGATTTCGGGA
TCAAAACGAGGAATTCTCAACCGGAGACGAAGAAACCGGGTTCCGAGTCGGGTCTTGGGTCTCCCAGAATCATCTCCGGC
TATTTCCCGGCGAGCGATATGGAGTTATCGGAGGATTACACATGCGTGACGTGTCACGGGCCTAACCCGAGAACCATTCA
TATATTCGATAACTGTATCGTTGAGAGCCAACCCGGCGTCGTTTTCTTCCGGAGCTCCGACCCGGTTAATGAATCGGATT
CGGATTATTCCCCACCCGACAGTTTTCTCAGTTGTTGCTGTAACTGTAAGAAGAGTCTTGGGCCTCGTGATGACATTTTC
ATGTACAGGGGAGATAGAGCTTTCTGTAGCAGTGAATGCAGGTCCATAGAGATGATGATGTCAGAGGAAAATGATACTAA
ATGA