Details for Arabidopsis Locus AT3G22490

Position : Chr3 ( 5`- 7969681 .. 7970843 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22490

Protein [Map View]
MSQEEQPKRPQEPVTYGDVFEVSGELADKPIAPEDANMMQAAETRVFGHTQKGGAAAVMQSAATANKRGGFVHPGDTTDL
AAERGVTVAQTDVPGARVTTEFVGGQVVGQYVEPRPVATAAAMEAEVVGLSLQSAITIGEALEATVQTAGNKPVDQSDAA
AIQAAEVRACGTNVIAPGGIAASAQSAANHNATIDRDEDKIKLIDVLAGATGKLAADKAVTRQDAEGVVSAELRNNPNLS
THPGGVAASITAAARLNERADI*

DNA
ATGAGTCAAGAAGAACAACCAAAGCGGCCACAAGAGCCAGTCACTTACGGTGACGTTTTTGAAGTCTCCGGTGAACTCGC
TGATAAGCCTATAGCGCCGGAGGATGCAAACATGATGCAAGCAGCGGAGACACGTGTGTTTGGCCACACTCAGAAAGGCG
GTGCAGCGGCAGTCATGCAGTCTGCAGCCACTGCTAATAAACGCGGTGGCTTTGTCCATCCAGGTGACACAACTGATCTC
GCCGCTGAACGAGGCGTCACAGTGGCGCAAACTGACGTCCCTGGTGCACGTGTCACAACAGAATTCGTCGGTGGACAGGT
CGTTGGACAATACGTCGAGCCTAGGCCAGTGGCGACTGCGGCAGCTATGGAAGCAGAAGTTGTGGGTTTGAGTTTACAAA
GTGCAATAACGATTGGAGAAGCATTGGAAGCGACTGTGCAAACCGCTGGAAACAAACCGGTGGATCAAAGCGACGCAGCA
GCGATTCAAGCGGCAGAGGTTAGAGCTTGTGGCACTAATGTGATTGCTCCTGGTGGAATCGCCGCTTCTGCTCAATCAGC
AGCAAATCACAACGCTACCATAGACCGTGATGAGGATAAAATCAAGCTCATTGATGTTTTGGCGGGTGCGACCGGGAAGT
TAGCCGCAGATAAAGCTGTGACCAGGCAGGACGCAGAGGGAGTGGTGAGCGCTGAGCTGAGGAACAATCCTAATTTGTCT
ACTCACCCTGGTGGTGTAGCGGCTTCTATTACTGCCGCCGCTAGGCTTAACGAGAGAGCTGATATATGA