Details for Arabidopsis Locus AT3G22480

Position : Chr3 ( 5`- 7968078 .. 7969705 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22480

Protein [Map View]
MASKSGSGGLREPPNEQAVLNMYEGKRSELSQIYSNITDLEMQVSEHSLVINAIQPLDQSRKCFRMIGGVLVERTIKEVL
PAVQRNKDGLEEVVRKLYETLEKKKKDLTEFEAKYKIRITKQEDNKEGGNKKEGNAQGVLVGAASSSQ*

DNA
ATGGCCAGCAAATCTGGAAGCGGTGGCCTAAGAGAACCGCCGAATGAGCAAGCTGTTTTGAACATGTATGAAGGCAAGAG
ATCAGAGCTAAGCCAAATCTACTCCAACATAACCGACCTCGAGATGCAAGTGAGCGAACATTCTCTGGTCATTAACGCCA
TTCAGCCTCTCGACCAATCGAGGAAATGCTTCCGCATGATAGGAGGCGTTCTTGTCGAAAGAACCATCAAAGAGGTACTA
CCAGCTGTCCAACGTAACAAGGACGGACTTGAAGAGGTTGTGAGGAAGCTATACGAGACATTGGAGAAAAAGAAGAAAGA
TCTTACAGAGTTTGAAGCTAAGTATAAGATCAGGATAACGAAACAAGAAGATAACAAGGAAGGAGGTAACAAGAAGGAAG
GTAATGCTCAAGGTGTTCTTGTTGGAGCTGCCAGTTCAAGCCAGTAA