Details for Arabidopsis Locus AT3G22430

Position : Chr3 ( 5`- 7953260 .. 7957884 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22430

Protein [Map View]
MVGSNNNAKSSTNKPPATSIPTAAASSSQNHKPRVNSTNNDGGISNNNNNNKKESKPMMIGVQKTADKKPLKPNPSPKLA
PIPKQSNPNHQNQTGPSSSRPMAPFPFPDSSPALGPPPQPTYGFHMLERRTIVLADGSVRSYFALPPNYMDFPPQSRLAG
PVFGRFPPFYPEEFRDQRMKRKYPGEEEIDRRDERAEMMRQRQQFMQYANPNDHSFMAGTSRDVGEDVRAAKHMRVGSSR
HDNGGFQVDQVALKKSFLGFVKRVFEDPMEKKNYLENGRKGRLQCLVCGRSSKDVQDTHSLVMHTYCSDDSSSRVHHLGL
HKALCVLMGWNFSKAPDNSKAYQNLPADEAAINQAQLIIWPPHVIVQNTSTGKGKEGRMEGFGNKTMDNRIRELGLTGGK
SKSLYGREGHLGITLFKFAGDDSGLRDAMRMAEYFEKINRGRKSWGRVQPLTPSKDDEKNPGLVEVDGRTGEKKRIFYGY
LATVTDLDKVDVETKKKTTIESLRELTRTK*

DNA
ATGGTCGGGAGCAACAACAACGCCAAGTCATCGACGAACAAGCCTCCAGCAACTTCCATCCCCACCGCTGCAGCTTCATC
TTCACAGAACCATAAACCTCGTGTGAATTCAACTAACAACGATGGTGGAATCAGTAACAACAACAACAACAACAAGAAAG
AAAGCAAGCCGATGATGATAGGTGTCCAGAAAACCGCCGATAAGAAACCACTGAAGCCTAATCCATCTCCTAAGCTAGCT
CCGATCCCGAAACAATCTAATCCGAATCATCAAAATCAAACGGGTCCATCATCTTCACGACCAATGGCTCCGTTTCCTTT
CCCTGATTCATCTCCCGCGCTAGGTCCTCCTCCTCAACCGACTTATGGATTCCATATGTTAGAGCGTCGCACAATTGTTC
TCGCTGATGGTAGTGTCCGTTCCTACTTCGCTCTTCCTCCTAATTACATGGATTTTCCTCCTCAGAGTCGATTAGCTGGA
CCGGTATTTGGGAGATTCCCTCCTTTTTACCCGGAAGAGTTTCGAGATCAGCGGATGAAACGGAAGTATCCAGGTGAAGA
AGAGATTGATAGGAGAGATGAGAGAGCTGAGATGATGAGACAGAGACAGCAGTTTATGCAGTATGCGAATCCTAATGATC
ACTCATTTATGGCTGGTACGAGTAGGGATGTTGGAGAGGATGTTAGAGCTGCTAAGCATATGAGGGTAGGATCAAGTAGG
CATGACAATGGAGGTTTCCAGGTTGACCAGGTTGCTCTAAAGAAATCGTTTTTGGGTTTTGTTAAGCGAGTTTTCGAGGA
TCCGATGGAGAAGAAGAACTACTTGGAGAACGGGAGAAAAGGGCGGCTTCAGTGTCTCGTTTGTGGCAGGTCTTCTAAAG
ATGTCCAGGATACACATAGTTTGGTAATGCACACATACTGTTCTGATGATTCTAGCTCACGCGTGCATCATTTAGGCCTA
CACAAAGCTCTCTGTGTATTGATGGGATGGAATTTCTCAAAGGCTCCTGATAATTCAAAGGCATACCAGAATCTACCTGC
TGATGAGGCAGCAATCAACCAAGCCCAGCTAATTATTTGGCCACCTCATGTTATTGTTCAGAATACCAGTACAGGGAAGG
GAAAAGAAGGGCGCATGGAAGGCTTTGGAAACAAAACAATGGATAACAGAATTAGAGAACTAGGACTCACTGGTGGGAAA
TCGAAGTCGTTGTATGGAAGAGAGGGTCATTTGGGAATTACCCTGTTCAAGTTTGCTGGAGACGATTCAGGGCTCAGGGA
TGCTATGAGAATGGCAGAATATTTTGAGAAGATAAACCGTGGGCGTAAGAGTTGGGGGAGGGTACAGCCACTCACTCCAA
GCAAAGATGATGAGAAAAACCCTGGTCTTGTCGAGGTTGATGGGAGGACGGGAGAGAAAAAGAGGATCTTTTATGGTTAT
CTCGCGACTGTAACGGACTTGGACAAAGTCGATGTGGAGACAAAGAAGAAAACCACAATCGAGAGCCTTAGAGAACTCAC
AAGAACAAAGTAA