Details for Arabidopsis Locus AT3G22415

Position : Chr3 ( 5`- 7941014 .. 7941564 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22415

Protein [Map View]
MCMFCGLYLWSLTHTLCKSNNDKSISLLSFWFRGFIHRMFMLEVKTKKIILNGMIHISVFSPHVLYI*

DNA
ATGTGCATGTTTTGTGGTCTATACTTGTGGAGTCTCACCCACACACTTTGCAAATCAAACAATGATAAATCCATTTCATT
ACTCTCTTTTTGGTTCAGAGGGTTCATACACCGAATGTTCATGCTCGAGGTCAAAACGAAGAAGATAATTCTTAATGGCA
TGATTCATATATCTGTTTTCTCTCCTCACGTACTGTACATATAA