Details for Arabidopsis Locus AT3G22410

Position : Chr3 ( 5`- 7933167 .. 7935808 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22410

Protein [Map View]
MGKKDEKVEAVLRLVKKQSPLTFKQEKFCNRECVERFLKVKGDNVKKAAKQLSSCLSWRQNFDIERLGAEEFSTELSDGV
AYISGHDRESRPVIIFRFKHDYQKLHTQKQFTRLVAFTIETAISSMSRNTEQSFVLLFDASFFRSSSAFANLLLATLKII
ADNYPCRLYKAFIIDPPSFFSYLWKGVRPFVELSTATMILSSLDYDEPLDITHVSSNPRSTSLRFDASSIKSTASIGSAS
SRFAFTVSQNSLKPWYLSFTDTSPYNPAVSSSAAAPVSPLSARSLPFASPAVRGFKDAKPAACRKSLFPSTPLPEKTKTV
SYRKTPRPSFFQSPAMFFRRENNVGGGGEKSREAFVPYLKFYRRPYDETAYRSKLRGPRGFLSVVSSHRRSRHVSLSQRF
*

DNA
ATGGGGAAGAAAGATGAGAAAGTCGAAGCTGTTCTTCGCTTGGTCAAGAAACAATCTCCACTCACTTTTAAACAAGAGAA
GTTCTGTAACAGAGAGTGTGTTGAGAGATTCTTGAAGGTGAAAGGAGATAATGTGAAAAAAGCAGCGAAACAACTCAGTT
CATGTCTTTCTTGGAGACAAAATTTCGATATTGAGCGATTGGGAGCAGAGGAGTTCTCGACGGAACTTAGCGACGGTGTA
GCTTACATCTCCGGCCACGACAGAGAATCAAGACCCGTTATTATTTTCCGTTTTAAGCATGATTATCAGAAGCTGCATAC
CCAAAAACAATTTACGCGTTTGGTAGCGTTCACGATTGAGACTGCGATTTCAAGCATGTCCAGAAACACGGAACAGAGCT
TTGTTCTTCTCTTTGATGCAAGCTTTTTCAGATCATCCTCTGCATTTGCGAATTTGCTTTTGGCGACCCTAAAAATCATC
GCAGATAATTACCCATGCCGACTTTACAAAGCCTTTATCATCGACCCTCCCTCTTTTTTCTCTTACCTTTGGAAGGGTGT
TCGTCCTTTTGTGGAGCTCTCAACGGCCACGATGATACTGTCGTCTCTAGACTACGACGAACCGCTAGATATCACCCACG
TGTCATCAAATCCTCGATCAACATCTTTAAGATTCGACGCATCGTCGATTAAATCAACGGCCTCGATTGGTTCAGCTTCT
TCAAGATTCGCTTTCACAGTCTCTCAGAACTCGTTGAAGCCGTGGTATCTTTCCTTCACCGACACGTCACCTTATAACCC
CGCCGTCTCATCCTCCGCCGCTGCTCCTGTTTCTCCTCTCAGTGCACGGTCGTTACCCTTCGCGTCTCCGGCGGTGCGTG
GTTTCAAAGACGCGAAACCAGCCGCATGCAGAAAGAGTCTGTTTCCATCGACGCCGTTGCCGGAGAAGACAAAGACGGTT
TCGTATCGGAAAACTCCACGTCCTTCGTTCTTTCAGTCGCCGGCGATGTTCTTTCGTCGGGAGAACAATGTCGGTGGAGG
AGGCGAGAAGTCACGTGAAGCGTTTGTACCGTATCTGAAGTTTTACCGGAGACCGTACGATGAGACTGCGTATAGGTCTA
AGTTACGTGGTCCACGTGGATTTCTGTCGGTCGTGTCTTCTCACAGAAGATCTCGCCACGTGTCTTTATCTCAACGGTTC
TGA