Details for Arabidopsis Locus AT3G22400

Position : Chr3 ( 5`- 7926879 .. 7931351 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22400

Protein [Map View]
MIHTDIAEILCVKPKTTKKTKTMEEDVKKTTTMKIEGEVVVMKKNLLDFKDVMASLLDRVNELLGRRVSLHLISSHQPDP
ANEKRGRLGKAAHLEKWVTKIKTSVTAEETAFGVTFDWDESMGPPAAFVIKNHHHSQFYLKSLTLRGFPDGEGGATAIHF
ICNSWIYPNHRYRSDRVFFSNKAYLPSETPELIKELREEELKNLRGNEKGGEFKEWDRVYDYAYYNDLGAPDKGPDSVRP
VLGGSPELPYPRRGKTGRKSTKSDPKSESRLALLNLNIYVPRDERFSHVKFSDFLAYALKSVTQVLVPEIASVCDKTINE
FDSFEDVFHLYDGSIKLANGHTISKLRDVIPWEMFRELVRNDGERFLKYPLPDILKESRSAWRTDEEFAREMLAGLNPVV
ISRLQEFPPKSCLDSAKYGNQHSSIRTEHIESNMNGLNVQEALEQNKLYILDHHDALMPYLTRINSTNTKTYATRTLLLL
QADGTLKPLAIELSLPHAQGESYGSVSKVFTPAEKGVEGSVWQLAKAYAAVNDSGYHQLISHWLQTHAVIEPFIIASNRQ
LSVVHPIHKLLHPHFRDTMNINALARHVLINSDGVLERTVFPSRYAMEMSSSIYKNWVFTEQALPKDLLKRGVAVEDPNS
DNGVKLLIEDYPFAVDGLEIWSAIKTWVTEYCTFYYNNDKTVQTDTEIQSWWTELRTKGHGDKRHESWWPSMQTRDDLIE
TCTIIIWIASALHAAVNFGQYPYAGFLPNRPTVSRRFMPEPGTDEYAELEEDADVAFLKTITPQLQTLLGISIIEILSMH
STDEIYLGQRDSPNWTADDEPLEAFKRFGKELELIENNIIRRNNDKRFKNRTGPVNIPYTLLYPNTTDYTREGGITGKGI
PNSVSI*

DNA
ATGATCCACACCGACATCGCAGAGATCTTATGCGTCAAACCCAAGACAACGAAGAAGACAAAAACAATGGAGGAAGATGT
CAAGAAGACGACGACGATGAAGATAGAAGGAGAAGTTGTTGTGATGAAGAAGAATCTCCTTGATTTCAAAGACGTTATGG
CTTCTCTTCTTGATCGTGTCAATGAGCTTCTTGGTCGTCGTGTCTCTCTCCACCTCATCAGCTCTCACCAACCCGACCCG
GCCAATGAGAAGAGAGGAAGACTTGGAAAAGCAGCACATCTGGAAAAATGGGTAACAAAAATAAAAACGTCAGTAACCGC
TGAGGAAACTGCGTTTGGAGTAACGTTTGATTGGGACGAGTCAATGGGACCACCGGCTGCATTTGTGATCAAGAACCACC
ACCATAGTCAATTCTACCTTAAGTCCCTCACCCTCCGCGGCTTCCCTGATGGCGAAGGTGGTGCCACTGCGATACATTTC
ATCTGCAATTCTTGGATTTACCCGAATCATCGATACCGCTCCGACCGCGTTTTCTTCTCTAACAAGGCATATCTTCCAAG
TGAAACACCGGAGCTAATCAAAGAGCTAAGAGAAGAAGAGCTAAAGAATCTAAGAGGCAATGAGAAAGGAGGAGAATTCA
AAGAATGGGACAGAGTTTACGACTACGCTTATTACAACGACTTGGGTGCTCCTGACAAGGGTCCTGACTCAGTTCGTCCG
GTTCTTGGCGGTTCACCTGAGCTGCCTTATCCTCGCCGTGGCAAAACCGGCCGTAAATCCACCAAATCAGACCCTAAGTC
TGAAAGCAGGCTGGCTTTACTAAACCTAAACATATACGTGCCAAGGGACGAGCGATTTAGCCATGTGAAGTTTTCAGACT
TCCTCGCTTATGCACTCAAGTCCGTGACTCAAGTGCTTGTCCCTGAGATCGCCTCTGTTTGCGACAAGACCATCAACGAG
TTTGACTCCTTCGAAGATGTTTTTCACCTCTATGACGGTAGTATTAAGCTCGCCAATGGTCACACCATTTCTAAGCTCCG
TGATGTTATCCCGTGGGAGATGTTTAGAGAGCTAGTTCGCAACGACGGAGAACGGTTCTTGAAGTATCCCTTGCCTGACA
TCCTCAAAGAGAGCAGATCGGCTTGGAGGACTGACGAAGAGTTTGCTCGAGAAATGCTGGCCGGTCTTAATCCGGTGGTG
ATTAGCCGTCTTCAGGAATTTCCACCAAAGAGCTGTCTGGACTCTGCAAAGTATGGAAACCAACACTCTTCCATACGAAC
AGAGCACATAGAATCAAACATGAACGGCCTCAATGTCCAAGAAGCTTTGGAACAGAATAAGCTATACATATTGGATCATC
ACGACGCATTGATGCCTTACCTGACACGGATAAACTCAACAAACACTAAAACCTATGCGACCCGAACCCTGCTGTTGCTT
CAAGCAGACGGAACACTGAAGCCTCTCGCCATAGAGCTGAGTCTTCCACACGCACAAGGCGAATCATATGGATCGGTCAG
CAAAGTTTTCACACCAGCAGAGAAAGGTGTCGAGGGATCGGTTTGGCAACTTGCTAAGGCTTATGCTGCGGTCAATGACT
CTGGTTATCATCAGCTTATAAGCCATTGGTTGCAAACGCATGCGGTGATTGAACCGTTCATAATCGCGTCCAATAGGCAG
CTCAGCGTGGTCCATCCGATCCATAAACTTCTACATCCTCATTTCCGTGACACTATGAACATCAACGCATTAGCGCGTCA
TGTACTCATAAACTCAGACGGAGTTCTTGAGAGAACAGTCTTCCCTAGTCGATACGCCATGGAAATGTCTTCTTCAATTT
ACAAGAATTGGGTTTTCACCGAGCAGGCTCTCCCAAAAGACCTCCTCAAACGAGGAGTTGCTGTTGAAGATCCAAACAGT
GACAACGGCGTTAAGCTTCTGATCGAAGATTACCCGTTTGCGGTCGACGGTTTAGAGATTTGGTCAGCGATCAAAACATG
GGTCACAGAGTACTGCACATTCTACTACAATAATGACAAAACCGTCCAAACGGATACAGAGATCCAATCATGGTGGACCG
AGCTCCGAACCAAAGGCCACGGCGACAAACGACACGAGTCATGGTGGCCTTCGATGCAAACCCGCGACGACCTAATCGAA
ACCTGCACGATCATCATCTGGATCGCCTCTGCTCTTCACGCAGCAGTAAATTTCGGACAGTACCCTTACGCCGGTTTTCT
CCCTAACCGTCCTACCGTCAGCCGCCGGTTTATGCCTGAACCAGGTACGGATGAGTATGCTGAGCTGGAGGAAGATGCTG
ACGTAGCGTTCTTGAAGACGATCACGCCGCAGTTACAGACTCTACTTGGTATCTCCATCATAGAGATATTGTCTATGCAT
TCAACGGACGAGATCTACTTAGGGCAAAGAGATTCACCGAATTGGACGGCGGATGATGAGCCTTTGGAGGCGTTTAAGCG
GTTTGGGAAAGAACTTGAGCTGATAGAGAACAATATTATACGAAGAAACAATGACAAGAGGTTCAAGAACAGAACCGGAC
CGGTTAACATACCGTACACATTGTTGTACCCGAATACTACGGATTATACGAGAGAAGGTGGGATTACTGGGAAAGGGATC
CCGAACAGTGTCTCAATCTAA