Details for Arabidopsis Locus AT3G22360

Position : Chr3 ( 5`- 7904156 .. 7905384 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22360

Protein [Map View]
MMMSRRYGAKLMETAVTHSHLLNPRVPLVTENIRVPAMGVVRVFSKMTFEKKKTTEEKGSSGGKADQGNKGEQLIVSYWG
VKPMKITKEDGTEWKWSCFRPWETYKSDLTIDLKKHHVPSTLPDKLAYWTVKSLRWPTDLFFQRRYGCRAMMLETVAAVP
GMVGGMLVHCKSLRRFEQSGGWIKALLEEAENERMHLMTFMEVAKPNWYERALVIAVQGIFFNAYFLGYLISPKFAHRMV
GYLEEEAIHSYTEFLKELDNGNIENVPAPAIAIDYWRLEADATLRDVVMVVRADEAHHRDVNHYASDIHYQGRELKEAPA
PIGYH*

DNA
ATGATGATGAGTCGTCGCTATGGAGCCAAGCTAATGGAAACTGCTGTGACTCACAGCCATCTTTTGAATCCTAGGGTTCC
TCTCGTGACGGAAAATATTAGGGTTCCGGCGATGGGAGTCGTGAGAGTTTTCAGCAAGATGACATTTGAGAAGAAGAAAA
CTACGGAGGAGAAAGGATCTAGCGGTGGCAAGGCTGATCAAGGTAACAAAGGGGAGCAATTAATCGTTAGCTACTGGGGA
GTGAAGCCGATGAAGATCACCAAAGAAGATGGAACTGAATGGAAATGGAGTTGCTTTAGGCCATGGGAGACATATAAATC
AGATCTGACTATAGATTTGAAGAAGCATCATGTTCCATCGACTTTACCGGACAAACTAGCTTATTGGACCGTGAAATCTC
TTCGATGGCCTACCGATCTTTTCTTCCAGAGGCGGTACGGATGCAGAGCAATGATGCTAGAAACGGTTGCAGCGGTTCCA
GGAATGGTTGGAGGGATGTTAGTACACTGCAAATCGCTTCGACGGTTTGAACAAAGCGGTGGTTGGATCAAAGCCCTACT
TGAAGAAGCAGAGAACGAGAGAATGCATTTAATGACATTCATGGAAGTCGCGAAACCTAATTGGTACGAACGAGCTCTTG
TGATTGCCGTTCAAGGCATTTTCTTCAATGCTTATTTCCTTGGATACCTAATTTCTCCCAAATTTGCTCATCGTATGGTT
GGATACCTTGAGGAAGAAGCAATCCACTCTTACACTGAGTTTCTTAAAGAACTCGATAATGGTAACATCGAAAATGTGCC
TGCACCGGCTATTGCCATTGATTACTGGAGACTTGAAGCTGATGCGACGCTTCGTGATGTCGTCATGGTGGTCCGTGCTG
ATGAAGCGCATCACCGTGATGTTAACCACTATGCATCCGATATTCATTACCAAGGTCGTGAGCTAAAAGAAGCTCCAGCT
CCCATTGGATATCATTGA