Details for Arabidopsis Locus AT3G22345

Position : Chr3 ( 5`- 7899215 .. 7900514 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22345

Protein [Map View]
MATAPKKKLISSDNDTEWSPVLAPDLIRSIFERLNFAEFHRAMSISLDWYSTAELCYRQNPTPWLILFSNYRHISCRLFD
PLHDKTYVIRDLGFDFHRSCCLATSGSWLLMLDHRTDFYLLNLFTRERICLPTLEAIDGWQMKFERVGESDFLKTFTYRE
GYRSYSSGLSTKVVIENAVLWVDERSRDYLVVWSIECFFAYHKKGDNNKTWKVIQLKKNEECSDIVFRESKLYVLNPNLN
ITVFDFSSGSPNECASFTSQDIGLTLYPLSCFGHLVITLSGEVLLIKTRRYGIYSFDVYKMDPKSSKWREIYSLGNEAIL
LDLGTTIAAKDGFG*

DNA
ATGGCAACGGCGCCGAAGAAGAAGTTGATTAGTTCCGACAACGATACAGAGTGGTCGCCGGTTCTTGCCCCTGACCTGAT
TCGATCGATCTTCGAACGTTTGAACTTTGCGGAGTTTCATCGAGCTATGTCAATTTCTTTAGATTGGTATTCCACTGCGG
AATTATGCTACAGACAAAACCCAACTCCATGGCTCATTCTCTTTTCAAACTATAGACATATTTCGTGTAGGTTGTTTGAT
CCTCTTCATGACAAAACCTACGTAATACGAGACCTAGGGTTTGATTTCCATAGGAGTTGTTGTTTGGCTACTTCTGGTAG
CTGGTTGTTGATGTTAGATCATAGAACCGATTTTTATCTTTTGAATCTGTTTACTCGAGAGAGGATTTGTCTTCCGACTT
TGGAAGCAATCGATGGATGGCAGATGAAGTTTGAGAGGGTTGGTGAGTCTGATTTCTTGAAGACATTCACTTATCGTGAA
GGCTATAGAAGTTATTCTTCTGGTCTAAGCACCAAAGTTGTAATAGAGAATGCGGTGTTGTGGGTCGATGAAAGAAGCCG
AGATTACTTAGTTGTGTGGAGCATTGAGTGCTTCTTTGCATATCATAAGAAAGGAGATAATAACAAGACCTGGAAAGTGA
TTCAATTAAAGAAGAATGAAGAGTGCTCCGATATAGTGTTTAGAGAAAGCAAGCTTTACGTGCTTAATCCAAATCTAAAC
ATTACTGTTTTTGATTTCTCTAGTGGTTCTCCAAATGAATGTGCAAGTTTCACATCTCAGGATATTGGTCTCACATTATA
TCCACTATCTTGTTTCGGCCATCTTGTTATAACTTTGTCCGGAGAGGTTTTGCTGATCAAAACCCGCCGATATGGGATAT
ATTCCTTTGATGTTTACAAGATGGATCCAAAATCATCAAAATGGAGAGAAATTTATTCTTTAGGGAATGAAGCAATTCTT
TTGGATCTAGGAACAACGATCGCAGCCAAAGATGGTTTTGGATAA