Details for Arabidopsis Locus AT3G22310

Position : Chr3 ( 5`- 7887286 .. 7890019 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22310

Protein [Map View]
MISTVLRRSILGTSRRTLAASVTSINAALFHNLAPAAATVSDLANGATNVKSLPSNSSPFGVKVRDFHVKSVPSEFRSSI
VSSAGFAAQEYAPSYENDGGIGDSESVGSSGGGDGLAIADLGISPEIVKALKGRGIEKLFPIQKAVLEPAMEGRDMIGRA
RTGTGKTLAFGIPIIDKIIKFNAKHGRGKNPQCLVLAPTRELARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGID
VAVGTPGRIIDLMKRGALNLSEVQFVVLDEADQMLQVGFAEDVEIILQKLPAKRQSMMFSATMPSWIRSLTKKYLNNPLT
IDLVGDSDQKLADGITMYSIAADSYGRASIIGPLVKEHGKGGKCIVFTQTKRDADRLAFGLAKSYKCEALHGDISQAQRE
RTLAGFRDGNFSILVATDVAARGLDVPNVDLVIHYELPNNTETFVHRTGRTGRAGKKGSAILIHGQDQTRAVKMIEKEVG
SRFNELPSIAVERGSASMFEGVGARSGGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGGGSYGGSGGSSS
RYSGGSDRSSGFGSFGSGGSSGGFGSDRSSQSSGRSSFGGFGSNDGKRSY*

DNA
ATGATTAGCACAGTACTTCGCCGATCTATCCTTGGTACGTCAAGGCGTACTCTCGCCGCTTCGGTGACCTCCATTAACGC
AGCTCTATTTCATAACCTTGCTCCAGCCGCCGCCACAGTCTCCGATCTAGCAAATGGAGCTACTAATGTCAAGTCTCTCC
CTTCGAATTCGAGCCCTTTTGGTGTTAAAGTGAGAGACTTTCATGTTAAATCTGTACCGTCGGAGTTTAGATCGTCGATT
GTTTCTTCTGCGGGATTCGCGGCTCAAGAGTATGCTCCTTCTTATGAGAACGATGGAGGGATTGGAGATTCGGAGAGTGT
TGGTAGCAGCGGTGGTGGTGATGGGCTTGCGATAGCTGATCTTGGTATATCTCCGGAGATTGTTAAAGCTTTGAAGGGTA
GGGGTATTGAGAAACTCTTTCCTATTCAGAAAGCTGTGTTGGAGCCAGCGATGGAGGGTCGTGATATGATTGGCCGTGCA
AGGACTGGAACGGGAAAGACACTTGCTTTTGGGATTCCTATTATTGACAAAATCATCAAATTCAACGCTAAACATGGTCG
TGGGAAGAATCCTCAGTGCTTGGTTTTGGCACCGACGAGGGAGCTTGCTCGTCAGGTTGAGAAAGAGTTCAGGGAATCTG
CTCCAAGTTTGGATACTATTTGTCTCTATGGAGGTACACCAATCGGGCAACAAATGAGGGAGCTGAACTATGGTATTGAT
GTGGCGGTTGGAACTCCTGGTCGTATCATTGATCTGATGAAAAGGGGAGCTTTGAATCTATCAGAGGTTCAGTTTGTGGT
TCTTGATGAAGCTGATCAGATGCTTCAAGTTGGATTTGCGGAAGATGTTGAAATAATATTGCAGAAGTTGCCAGCGAAGC
GTCAGAGTATGATGTTTTCTGCAACAATGCCAAGTTGGATCAGATCTCTCACCAAGAAGTACCTGAACAATCCTTTGACA
ATTGATCTTGTTGGAGATTCAGATCAGAAACTTGCAGATGGGATTACTATGTATTCTATCGCTGCAGATTCTTATGGAAG
AGCATCCATCATTGGTCCTCTTGTAAAGGAACATGGCAAAGGAGGAAAATGCATTGTCTTTACCCAAACAAAACGTGATG
CAGATCGCCTTGCATTTGGATTGGCAAAAAGCTATAAATGTGAAGCTTTACACGGTGACATATCTCAAGCTCAGAGAGAA
AGAACACTTGCTGGTTTCAGGGATGGGAATTTCAGTATTCTTGTTGCAACTGATGTTGCTGCCCGTGGACTTGATGTACC
TAATGTCGATTTAGTAATTCATTATGAGCTTCCTAATAACACGGAGACGTTTGTTCACCGAACGGGGCGAACTGGTCGTG
CTGGAAAGAAAGGAAGCGCGATTCTCATCCACGGTCAAGATCAAACCAGGGCTGTTAAAATGATTGAGAAAGAAGTCGGA
AGCAGATTCAATGAGCTGCCTAGCATTGCTGTGGAAAGAGGAAGCGCAAGCATGTTTGAAGGAGTAGGTGCTAGATCTGG
TGGGTCGTTCGGAGGAGGTCGATCAGGCGGTGGTGGGTATGGTAGTTACGGTAGCAGCAGTGGCCGTTCAGGTGGTGGTA
GTTATGGAGGTTATGGTGGCAGCAGTGGCCGTTCAGGTGGTGGTGGTGGTAGTTATGGAGGTTCAGGGGGATCAAGCAGC
CGTTACTCTGGTGGTTCAGACCGCTCATCTGGTTTCGGAAGCTTTGGTTCAGGCGGTTCTTCAGGAGGATTTGGTTCAGA
CCGTTCTTCTCAGTCAAGTGGAAGGAGCAGCTTTGGTGGGTTTGGATCAAACGATGGTAAAAGATCTTACTGA