Details for Arabidopsis Locus AT3G22300

Position : Chr3 ( 5`- 7885668 .. 7886820 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22300

Protein [Map View]
MIAGVLRRSSLPSRQTLSAALASFNSCISHNLTPATTGASVSSRFTLASSPNSFGIRARNIHIRSEPSMIVPAGIASQGY
ATVTKDRKNEIKKAKIKISPDNVRPLSRKEIALQKEAAEESTSKIKGTKICIAIRSFVNPEKQAWCLPPHTRKVAMPDTR
TLYTVLRSPHVDKKSREQFEMRFKKRFLVIKAQSHELSKKLFWLKRYRILGAQYELQFHCKTRLDMTQVLGNINGSTTNA
Y*

DNA
ATGATCGCCGGAGTATTGCGCCGATCTTCACTCCCGTCGAGGCAGACTCTCTCCGCCGCGTTAGCCTCCTTCAATTCGTG
TATTTCGCACAATCTCACTCCAGCCACCACCGGAGCTTCCGTCAGCTCTCGATTCACTCTCGCGTCGTCTCCTAACTCGT
TTGGCATCAGAGCGAGGAACATCCACATTAGATCTGAGCCGTCGATGATTGTTCCCGCAGGAATCGCGTCACAAGGTTAC
GCCACTGTCACAAAGGATCGCAAAAACGAGATTAAGAAAGCTAAGATTAAAATTTCTCCAGACAATGTCAGACCATTGAG
TAGGAAGGAGATCGCTCTCCAGAAAGAGGCAGCAGAAGAAAGCACATCAAAGATAAAAGGAACAAAGATTTGTATAGCGA
TTCGGTCTTTTGTTAACCCGGAAAAGCAAGCTTGGTGTCTTCCTCCTCACACTCGTAAAGTCGCAATGCCCGATACACGA
ACTCTGTACACGGTGCTAAGATCGCCTCACGTCGATAAGAAGTCTAGAGAACAGTTTGAGATGAGGTTCAAGAAACGGTT
TCTTGTCATCAAAGCTCAGAGTCATGAGTTGAGCAAGAAGCTGTTTTGGTTAAAACGTTATCGTATTCTTGGAGCTCAAT
ATGAACTCCAGTTCCATTGCAAGACCCGTTTGGATATGACTCAAGTGTTAGGCAACATCAATGGCTCCACCACCAATGCT
TACTGA