Details for Arabidopsis Locus AT3G22260

Position : Chr3 ( 5`- 7870892 .. 7873548 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22260

Protein [Map View]
MDENHRNPFANASTSARASGSTSASSNSSFSSSVADTDDDQTIARILAEDESLRREGKLGKRLSHLDSIPHTPRVNREIP
DINDATLDHELLSGRLATYGLAELQMEGDGNCQFRALADQLFRNADYHKHVRKHVVKQLKQQRKLYEEYVPMKYRHYTRK
MKKHGEWGDHVTLQAAADRFEAKICLVTSFRDQSYIEILPHNKNPLREAWLSFWSEVHYNSLYANGVLALPDVPTRKPRR
KHWLF*

DNA
ATGGATGAAAACCATAGGAATCCATTTGCAAATGCAAGTACAAGTGCTAGAGCAAGCGGCAGTACAAGTGCGAGCTCAAA
CTCGAGTTTTAGTAGCAGTGTGGCGGATACAGATGATGATCAGACCATTGCACGTATATTAGCTGAAGATGAGAGCTTGA
GAAGAGAAGGCAAGCTTGGGAAGAGATTATCTCATTTGGATTCTATCCCACACACTCCTCGGGTTAACAGGGAGATACCT
GATATAAATGATGCAACATTAGACCATGAGCTGCTCTCTGGGAGGTTGGCCACATATGGTTTAGCGGAATTGCAAATGGA
GGGAGATGGAAATTGCCAGTTTCGAGCTTTAGCAGACCAGCTTTTCCGCAATGCAGATTACCATAAACATGTAAGGAAGC
ATGTTGTAAAGCAGTTAAAACAACAACGGAAGTTATACGAAGAATATGTGCCAATGAAATACAGACACTACACCAGGAAG
ATGAAAAAACATGGTGAATGGGGAGATCATGTTACTCTTCAAGCTGCAGCGGATAGATTCGAAGCCAAGATCTGCTTAGT
CACATCCTTTCGGGATCAATCCTACATCGAGATTCTTCCTCATAACAAGAACCCTCTTAGAGAGGCTTGGCTCAGCTTCT
GGAGCGAAGTGCATTACAATTCTTTATACGCTAATGGAGTTCTTGCTCTTCCAGATGTTCCAACAAGAAAACCGAGAAGG
AAGCATTGGCTCTTCTAG