Details for Arabidopsis Locus AT3G22231

Position : Chr3 ( 5`- 7845823 .. 7846605 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22231

Protein [Map View]
MNQSAQNYFSVQKPSETSSGPYTSPPPIGYPTRDAVVGDPPAAAVETNSKGVNPEAIMSCFSTCMECIFCCGVCSSLCTS
E*

DNA
ATGAATCAATCCGCGCAAAATTACTTTTCCGTGCAAAAACCTTCAGAGACTTCATCAGGGCCGTACACAAGTCCGCCACC
AATTGGTTATCCGACTAGAGATGCGGTGGTGGGTGATCCTCCGGCAGCAGCAGTGGAGACAAACTCCAAGGGCGTCAACC
CCGAAGCCATAATGAGTTGTTTTAGTACTTGTATGGAGTGTATCTTCTGCTGCGGCGTATGCTCCAGCCTCTGTACATCA
GAGTAA