Details for Arabidopsis Locus AT3G22210

Position : Chr3 ( 5`- 7838784 .. 7839467 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22210

Protein [Map View]
MEGISHIALPVLGIVAVSVVTFYAVSFAEIREKSFKDVYDSENEVGFKTSLSSRERRSKREANKKRPKS*

DNA
ATGGAAGGGATAAGCCATATCGCACTCCCTGTTCTTGGAATCGTCGCAGTCTCGGTCGTAACATTCTATGCCGTTAGCTT
TGCCGAGATCAGAGAGAAATCGTTTAAAGATGTGTACGACTCGGAGAACGAAGTTGGGTTCAAGACTTCTCTAAGTTCAA
GGGAGAGAAGATCAAAGAGAGAAGCAAACAAAAAACGTCCTAAATCTTGA