Details for Arabidopsis Locus AT3G22190

Position : Chr3 ( 5`- 7830905 .. 7834049 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22190

Protein [Map View]
MGASGRWIKALVGFTKSDKSRSSKKDENVKVATKSRFGRKNSVDFDFEKFQDGFEDSNTRSMVDTGVSTSTSLQSYGGVA
YDEQSRENRAATRIQTAYRGFLARRALRALKGLVRLQALVRGHAVRKQAAVTLRCMQALVRVQARVRARRVRLALELESE
TSQQTLQQQLADEARVREIEEGWCDSIGSVEQIQAKLLKRQEAAAKRERAMAYALTHQWQAGTRLLSAHSGFQPDKNNWG
WNWLERWMAVRPWENRFLDSNLRDDAKLGENGMEQSENVPKTQIKSVSKMPNTSNLVSGVSSQMTGPCQSDGDSSSPGIS
SSIPVVSKAKSKPAKDDLAVEVNSRPGAGPRSHSNPKERSREPNRSSKERLSLPNSGKSLGSQSTKANRAGKLTPASQKV
VEEKSAQNQRRRNSDPIKQRLA*

DNA
ATGGGAGCTTCAGGGAGATGGATTAAAGCATTGGTTGGTTTTACTAAATCTGATAAGTCTAGGTCTTCCAAGAAAGATGA
AAATGTGAAGGTTGCTACCAAGAGTAGGTTTGGGAGAAAGAATTCAGTTGATTTTGACTTTGAAAAGTTTCAAGATGGAT
TTGAAGATTCCAATACGCGTAGTATGGTTGATACTGGGGTCTCTACTTCAACTTCACTACAATCATATGGGGGTGTTGCT
TATGACGAACAAAGTAGGGAAAATCGGGCTGCAACGCGTATCCAAACGGCTTATCGGGGATTTCTGGCTAGGAGGGCTTT
ACGAGCGTTGAAGGGATTGGTTAGACTTCAAGCCCTTGTTAGAGGACATGCTGTGAGAAAACAAGCTGCTGTAACGCTTC
GATGCATGCAAGCGTTGGTAAGAGTTCAGGCTCGTGTACGCGCAAGACGTGTTCGTCTCGCCTTGGAATTGGAAAGTGAG
ACGAGTCAGCAGACACTTCAACAACAGTTAGCAGATGAAGCCCGAGTTCGAGAAATAGAGGAAGGTTGGTGCGATAGCAT
TGGATCTGTTGAACAAATTCAAGCCAAGCTGCTAAAGAGGCAGGAAGCTGCAGCTAAGCGTGAGAGAGCGATGGCATATG
CTTTGACTCACCAGTGGCAGGCAGGAACTCGGCTGTTATCTGCTCACAGTGGCTTTCAACCTGACAAAAACAATTGGGGA
TGGAACTGGTTGGAAAGATGGATGGCAGTGCGTCCATGGGAGAACCGGTTTCTTGACAGTAACCTCAGGGATGATGCAAA
ATTAGGTGAAAACGGCATGGAGCAGTCTGAGAATGTACCTAAAACGCAGATCAAAAGTGTGAGTAAGATGCCAAACACTT
CAAATCTTGTATCCGGTGTTTCAAGTCAGATGACTGGCCCGTGTCAGTCGGATGGTGATTCGTCTTCTCCTGGAATATCT
TCAAGCATTCCAGTGGTATCCAAGGCTAAGTCAAAGCCAGCTAAAGACGATCTTGCTGTAGAAGTTAACTCAAGACCTGG
TGCTGGTCCAAGATCACACAGCAATCCGAAAGAAAGATCAAGAGAACCAAATCGATCTTCAAAAGAACGATTATCTCTGC
CAAACAGCGGAAAATCCTTAGGATCTCAGTCAACTAAAGCCAACCGAGCAGGAAAACTCACGCCAGCATCTCAAAAAGTA
GTGGAGGAAAAATCTGCCCAAAACCAGAGAAGGCGCAACTCCGACCCAATAAAACAGAGGCTTGCATAG