Details for Arabidopsis Locus AT3G22180

Position : Chr3 ( 5`- 7827036 .. 7830813 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22180

Protein [Map View]
MVRKHGWQLPAHTLQVIAITVFCLLVVAFYAFFAPFVGGRIWEYVLIGVYSPVAILVFVLYVRCTAINPADPRIMSIFDT
GVNGDGMVRGLSRNYDETGSQLQASPSVVSRSSTVAGNSSVKGSVEDAQRVESVSRRSCYNPLAVFCYVFVVEDCRKKEG
PAEEQGNSEEALFCTLCNCEVRKFSKHCRSCDKCVDCFDHHCKWLNNCVGRKNYVTFVSLMSASLLWLIIEAAVGIAVIV
RVFVNKQTMETEIVNRLGNSFSRAPLAAVVGLCTAVAIFACFPLGELLFFHMLLIKKGITTYEYVVAMRAMSEAPDGASV
DEEIQNVLYSPTGSATTGFSGGSSLGLPYRGVWCTPPRVFDNQDEVIPHLDPCMVPSTVDPDAPGSEKGTKALKRPVKRN
AWKLAKLDPNEAARAAARARASSSVLRPIDNRHLPDNDLSSIGTVSIISSVSTDANVAASKEIRNNDLRSSLSRNSFAPS
QGSRDEYDTGSHGMSNLSSPSHVHESVTLAPLPQNPTIVGNRFTATSHHMHSTFDDKVLHRGNDADPLFLFAPATSHLRD
VRKTSVVWDPEAGRYVSAPVTTTSEVRNRLLNPSSQTASTQNPRPILPAHDSSSGSSALRDPLPLHQAERRLTYTGDSIF
YGGPLINIPTRDTPRSGRGLVRDVQDRLASTVHRDARIRRDSTSNQLPVFAPGGLGANSQTGSNIK*

DNA
ATGGTGAGGAAACACGGTTGGCAACTTCCCGCTCACACTCTTCAGGTGATTGCAATTACGGTGTTTTGCTTGTTGGTGGT
CGCTTTCTATGCTTTCTTCGCTCCTTTTGTTGGAGGTCGTATTTGGGAATACGTTTTGATCGGTGTTTACTCTCCCGTGG
CTATTCTTGTGTTTGTTTTGTATGTTCGGTGTACTGCAATCAATCCTGCGGATCCGAGAATCATGTCGATATTTGATACA
GGCGTGAATGGAGATGGCATGGTTCGTGGCTTATCAAGGAATTATGATGAAACTGGTAGTCAGTTGCAGGCTTCTCCTTC
GGTTGTCAGTAGGAGTTCTACCGTGGCTGGAAACTCTAGTGTGAAAGGTTCTGTAGAAGATGCTCAAAGAGTGGAATCTG
TAAGTAGAAGATCTTGCTATAATCCTCTGGCAGTTTTCTGTTATGTGTTTGTTGTGGAAGACTGCCGGAAAAAGGAAGGG
CCGGCGGAAGAACAAGGAAACAGCGAAGAGGCTCTGTTTTGCACATTGTGCAATTGTGAGGTACGCAAGTTCAGCAAGCA
TTGTCGAAGTTGTGATAAATGTGTTGATTGTTTTGATCACCATTGCAAGTGGCTTAACAATTGTGTCGGTCGTAAAAACT
ATGTGACTTTTGTCTCTCTGATGAGTGCCAGTCTTCTCTGGCTCATTATTGAAGCAGCAGTTGGAATTGCAGTTATAGTG
CGTGTATTTGTTAATAAGCAGACCATGGAAACTGAAATTGTCAATAGACTTGGAAATAGTTTCTCTCGTGCACCTTTGGC
GGCAGTTGTTGGTCTTTGCACTGCTGTTGCCATTTTCGCATGTTTTCCACTGGGTGAACTTCTCTTTTTCCACATGCTTC
TCATTAAAAAGGGAATTACAACATATGAGTATGTTGTGGCAATGAGAGCCATGAGCGAGGCGCCAGATGGAGCATCTGTT
GACGAGGAAATTCAGAATGTGCTCTATTCTCCCACTGGGTCTGCTACAACCGGCTTTAGTGGTGGAAGCTCTCTCGGTTT
ACCATACAGGGGGGTCTGGTGCACTCCACCTAGAGTGTTTGATAATCAGGATGAAGTCATTCCTCATTTAGACCCTTGCA
TGGTCCCGTCAACCGTAGACCCAGATGCACCTGGATCAGAGAAAGGCACTAAGGCTCTGAAAAGACCTGTAAAACGTAAT
GCATGGAAGCTTGCAAAGTTGGATCCAAATGAAGCTGCAAGGGCAGCTGCCAGAGCCAGAGCGTCATCATCTGTCCTAAG
ACCGATAGATAATCGCCATTTACCTGATAATGATCTTAGTTCCATTGGCACAGTTAGTATCATCAGTAGTGTAAGCACAG
ATGCAAATGTGGCTGCAAGTAAAGAGATAAGGAACAATGATCTAAGGTCATCTCTTTCTAGAAACTCGTTTGCTCCAAGC
CAAGGTAGCCGGGATGAGTATGACACAGGGAGCCATGGTATGAGCAATCTTAGCAGTCCAAGCCATGTTCACGAGTCTGT
CACACTTGCTCCACTCCCTCAAAATCCTACAATAGTTGGCAATCGCTTCACTGCAACAAGCCATCACATGCACTCGACCT
TTGATGATAAGGTTCTGCACAGAGGAAACGACGCGGATCCGCTATTTCTCTTTGCTCCTGCAACTTCTCATCTGAGGGAT
GTGAGAAAGACATCAGTTGTTTGGGATCCAGAAGCTGGGAGATATGTATCAGCTCCTGTAACAACAACATCTGAAGTCCG
CAACAGATTGCTAAATCCTAGCTCACAAACAGCCAGCACTCAGAATCCAAGACCCATTCTTCCAGCTCATGATTCTTCTT
CTGGATCATCAGCACTAAGGGATCCTCTTCCTCTGCACCAAGCCGAGAGAAGACTGACATATACAGGTGACTCTATCTTT
TATGGAGGCCCTTTGATTAATATTCCGACTAGAGATACCCCGAGAAGCGGAAGGGGCTTGGTAAGAGATGTACAAGACAG
ATTGGCATCAACAGTTCATCGAGATGCAAGAATTAGAAGGGATTCAACCTCAAACCAGCTTCCGGTGTTTGCCCCTGGAG
GTCTTGGGGCAAACTCCCAAACCGGTTCTAACATCAAGTAG