Details for Arabidopsis Locus AT3G22160

Position : Chr3 ( 5`- 7817857 .. 7818985 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22160

Protein [Map View]
MANPNEWSQFYNNNQTFFTTSTTASTAVTTTTAGDTTSIDSRLSPETGRVTKPTRRRSRASRRTPTTLLNTDTSNFRAMV
QQYTGGPSAMAFGSGNTTSAFSLTSSSDPSAGSSQQAPWQYNFQPHAPLQPPQRPYMFSLNNVNPVVGYSNMNNPNTMVS
GVFGTVDGSGGGGSAPSSKEATNSNSSSSRLQ*

DNA
ATGGCTAACCCCAACGAGTGGTCTCAGTTCTACAACAATAACCAAACCTTCTTCACAACTTCTACCACCGCTTCAACCGC
TGTTACAACCACCACTGCCGGTGATACCACCTCCATAGACTCTCGTCTGAGTCCAGAAACTGGCCGTGTAACCAAGCCAA
CACGTAGAAGGTCCAGAGCCTCACGTAGAACACCAACAACGCTTCTCAACACCGACACTTCCAACTTCCGTGCCATGGTT
CAGCAATACACTGGCGGTCCATCCGCTATGGCTTTCGGGTCCGGTAATACTACTTCTGCTTTTAGCCTCACTTCATCGTC
GGATCCATCAGCTGGATCTTCTCAACAAGCTCCTTGGCAATATAATTTCCAGCCTCACGCGCCGCTTCAGCCACCGCAAC
GGCCTTACATGTTTTCTTTGAACAACGTGAATCCCGTGGTTGGATATAGTAACATGAACAACCCTAATACGATGGTTTCC
GGTGTGTTTGGGACGGTGGATGGTTCTGGTGGAGGAGGTTCTGCTCCGTCGTCAAAGGAGGCTACGAATAGTAATTCTTC
TTCTTCGAGGTTGCAATGA