Details for Arabidopsis Locus AT3G22150

Position : Chr3 ( 5`- 7812944 .. 7815928 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22150

Protein [Map View]
MAGSALPLPPPPPLSLQSPSQNQTRHSSTFSPPTLTPQTPSIRSRLSKICQDGNPQLARQLFDAIPKPTTVLWNTIIIGF
ICNNLPHEALLFYSRMKKTAPFTNCDAYTYSSTLKACAETKNLKAGKAVHCHLIRCLQNSSRVVHNSLMNMYVSCLNAPD
CFEYDVVRKVFDNMRRKNVVAWNTLISWYVKTGRNAEACRQFGIMMRMEVKPSPVSFVNVFPAVSISRSIKKANVFYGLM
LKLGDEYVKDLFVVSSAISMYAELGDIESSRRVFDSCVERNIEVWNTMIGVYVQNDCLVESIELFLEAIGSKEIVSDEVT
YLLAASAVSALQQVELGRQFHGFVSKNFRELPIVIVNSLMVMYSRCGSVHKSFGVFLSMRERDVVSWNTMISAFVQNGLD
DEGLMLVYEMQKQGFKIDYITVTALLSAASNLRNKEIGKQTHAFLIRQGIQFEGMNSYLIDMYSKSGLIRISQKLFEGSG
YAERDQATWNSMISGYTQNGHTEKTFLVFRKMLEQNIRPNAVTVASILPACSQIGSVDLGKQLHGFSIRQYLDQNVFVAS
ALVDMYSKAGAIKYAEDMFSQTKERNSVTYTTMILGYGQHGMGERAISLFLSMQESGIKPDAITFVAVLSACSYSGLIDE
GLKIFEEMREVYNIQPSSEHYCCITDMLGRVGRVNEAYEFVKGLGEEGNIAELWGSLLGSCKLHGELELAETVSERLAKF
DKGKNFSGYEVLLSNMYAEEQKWKSVDKVRRGMREKGLKKEVGRSGIEIAGYVNCFVSRDQEHPHSSEIYDVIDGLAKDM
RGDSFLTTLPTVTPSLELDE*

DNA
ATGGCTGGATCAGCTCTACCTCTACCACCTCCTCCACCACTATCATTACAATCTCCGTCACAAAATCAAACCCGTCATTC
TTCTACCTTTTCTCCACCAACCCTTACTCCTCAAACACCTTCTATCCGTTCCCGTCTTAGCAAAATCTGTCAAGATGGAA
ACCCACAACTTGCACGCCAATTGTTCGACGCAATTCCTAAACCAACTACTGTTCTTTGGAACACTATCATCATCGGGTTT
ATTTGTAATAATCTACCACACGAAGCTCTTCTTTTCTATTCCCGGATGAAAAAGACGGCACCTTTTACTAATTGTGATGC
TTATACTTACTCTTCTACACTCAAGGCGTGTGCTGAGACTAAGAATTTGAAAGCTGGTAAAGCTGTGCATTGTCATTTGA
TCCGTTGTTTACAGAATTCAAGCAGAGTTGTGCATAATTCTTTGATGAATATGTATGTTTCTTGTTTGAATGCTCCTGAT
TGTTTTGAGTATGATGTTGTGCGTAAAGTTTTCGATAATATGCGTAGGAAGAATGTTGTCGCTTGGAATACTTTGATTTC
TTGGTATGTGAAAACAGGGAGAAATGCTGAAGCTTGTAGGCAATTTGGGATAATGATGAGAATGGAGGTAAAACCGAGCC
CGGTTAGCTTTGTTAATGTTTTTCCTGCGGTGTCGATTTCGAGAAGCATTAAGAAAGCTAACGTTTTTTATGGTTTGATG
CTTAAATTGGGAGATGAATATGTGAAGGACTTGTTTGTGGTTAGTTCGGCTATTTCTATGTATGCTGAGCTTGGTGATAT
TGAGTCATCAAGGAGAGTGTTTGATTCTTGTGTTGAGAGAAACATCGAGGTTTGGAATACAATGATAGGTGTTTATGTTC
AGAATGATTGTCTGGTTGAAAGTATTGAGCTTTTTCTTGAAGCGATAGGATCGAAAGAGATTGTGTCTGATGAAGTAACG
TACCTCTTGGCAGCGAGTGCTGTTTCAGCGTTGCAGCAAGTAGAACTAGGCAGGCAGTTTCATGGTTTTGTGAGCAAGAA
CTTTCGAGAGCTACCGATTGTGATTGTTAACTCGTTGATGGTGATGTACTCAAGGTGTGGTTCTGTGCACAAGTCATTTG
GAGTCTTTCTTTCCATGCGAGAGAGAGATGTTGTATCGTGGAACACTATGATCTCTGCATTTGTCCAAAATGGCTTAGAT
GATGAAGGATTGATGCTGGTTTACGAGATGCAGAAGCAAGGGTTTAAGATTGATTACATAACTGTGACAGCTTTGCTTTC
GGCTGCATCAAATCTTAGAAACAAGGAGATCGGGAAGCAGACTCACGCTTTCCTTATCAGGCAAGGGATTCAGTTCGAGG
GAATGAACAGTTACCTTATCGACATGTATTCTAAGTCAGGTCTAATTAGGATATCACAGAAGCTTTTTGAAGGAAGTGGT
TATGCTGAAAGAGATCAGGCTACTTGGAATTCTATGATTTCCGGGTACACGCAGAATGGACACACAGAGAAAACGTTTCT
AGTGTTCAGGAAGATGTTAGAACAGAATATACGACCCAATGCGGTAACTGTGGCATCAATTCTCCCTGCTTGTAGCCAAA
TAGGTAGTGTTGACTTGGGTAAACAGCTCCATGGTTTCTCTATCAGGCAATACTTGGATCAGAACGTATTTGTGGCTTCT
GCGTTAGTAGATATGTATTCAAAGGCAGGAGCAATAAAGTATGCAGAAGACATGTTTTCTCAAACGAAAGAGAGAAATTC
TGTGACATACACCACGATGATACTGGGGTATGGCCAACATGGAATGGGCGAGAGAGCTATCTCGCTGTTTCTCTCAATGC
AAGAGTCGGGAATCAAACCCGATGCTATAACCTTTGTTGCAGTGTTATCAGCTTGCAGCTATTCAGGTCTAATAGATGAA
GGTCTCAAAATATTCGAGGAAATGAGAGAAGTTTATAACATTCAGCCTTCAAGTGAGCACTATTGCTGCATTACAGATAT
GTTGGGGAGAGTTGGGCGGGTGAATGAAGCCTACGAGTTTGTTAAAGGACTTGGTGAAGAAGGGAACATAGCTGAGCTAT
GGGGTTCACTACTCGGGTCTTGTAAACTACACGGTGAGCTTGAGCTTGCTGAAACTGTTTCGGAGAGGTTGGCTAAATTT
GATAAAGGGAAGAACTTTTCCGGGTATGAGGTTTTGCTCTCGAATATGTATGCTGAGGAACAAAAATGGAAGAGCGTTGA
TAAGGTGAGGAGAGGAATGAGAGAAAAAGGTTTAAAGAAAGAAGTTGGTCGTAGTGGGATTGAAATTGCAGGTTACGTCA
ACTGTTTTGTGTCTAGAGATCAAGAGCATCCTCATTCTAGTGAGATTTATGATGTAATCGACGGTTTGGCTAAAGATATG
AGAGGCGATTCGTTTCTGACAACATTGCCAACTGTTACTCCAAGTTTGGAATTGGATGAGTGA