Details for Arabidopsis Locus AT3G22120

Position : Chr3 ( 5`- 7794957 .. 7796310 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22120

Protein [Map View]
MGSRSQNLSFLVLLLLGFVAVSYACDCTPPKPSPAPHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVK
PHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPP
TPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTP
TPPTPIPETCPIDTLKLGACVDVLGGLIHIGLGKSHAKAECCPVLGGLLDLDAAVCLCTTIKLKLLNIDLVLPIALELLL
DCGKTPPSDFKCPA*

DNA
ATGGGGTCTCGCTCTCAAAACCTCTCCTTTCTCGTCCTCCTCCTCCTTGGCTTCGTTGCCGTCTCCTATGCTTGCGACTG
TACCCCTCCTAAACCATCACCAGCACCTCACAAACCACCAAAACATCCAGTCAAACCGCCTAAACCTCCTGCCGTCAAAC
CACCTAAACCACCGGCAGTAAAACCACCTACTCCAAAACCTCCCACCGTGAAACCCCATCCTAAACCACCAACCGTCAAA
CCCCATCCTAAACCACCAACCGTCAAACCCCACCCTAAGCCACCCACCGTCAAACCACCCCACCCTAAACCACCCACCAA
ACCTCACCCCCACCCAAAACCTCCCATCGTAAAGCCACCAACCAAGCCTCCTCCGTCCACCCCTAAACCTCCCACCAAAC
CTCCCCCGTCCACACCTAAACCTCCCACGACCAAGCCTCCTCCGTCTACTCCGAAACCACCCCACCACAAGCCTCCGCCT
ACACCATGCCCACCACCAACACCAACGCCGACTCCACCAGTTGTAACACCGCCAACACCAACCCCACCCGTCATAACTCC
ACCAACACCAACCCCACCCGTCGTAACACCGCCAACGCCAACTCCACCCGTCATTACACCACCAACACCAACTCCACCCG
TCATTACACCACCAACACCAACACCACCCGTCGTGACACCTCCAACACCAACACCACCCGTAGTAACACCACCAACACCA
ACTCCTCCTACGCCTATTCCAGAGACTTGCCCAATTGACACGCTGAAGCTAGGCGCTTGTGTGGACGTTCTTGGAGGTTT
GATTCACATCGGACTTGGAAAAAGCCACGCCAAGGCAGAATGTTGTCCGGTTTTAGGAGGTTTACTTGACCTAGACGCAG
CCGTTTGTCTATGTACCACCATTAAGCTCAAACTTCTCAACATCGACCTTGTTCTCCCCATTGCTCTTGAGCTTCTTCTC
GACTGTGGAAAAACTCCACCATCTGACTTCAAATGTCCCGCTTAA