Details for Arabidopsis Locus AT3G22110

Position : Chr3 ( 5`- 7792638 .. 7794165 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22110

Protein [Map View]
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILSKDGVVLIGEKKVTSKLLQTSTSAEKMYKIDDHVACAVAGIM
SDANILINTARVQAQRYTFMYQEPMPVEQLVQSLCDTKQGYTQFGGLRPFGVSFLFAGWDKHHGFQLYMSDPSGNYGGWK
AAAVGANNQAAQSILKQDYKDDATREEAVELALKVLTKTMDSTSLTSEKLELAEVYLTPSKTVKYHVHSPESLTKLLVKH
GVTQPAAETS*

DNA
ATGTCTCGGAGATATGATAGCCGTACCACAATCTTCTCGCCAGAAGGTCGTCTTTACCAGGTAGAGTATGCTATGGAGGC
CATTGGAAACGCCGGTTCTGCGATTGGAATCTTATCCAAAGACGGTGTTGTGTTGATCGGTGAGAAGAAAGTCACCTCAA
AGCTTCTTCAAACCTCAACCTCTGCTGAGAAAATGTACAAGATTGATGACCATGTTGCCTGTGCTGTTGCTGGTATAATG
TCTGATGCTAACATACTTATCAACACGGCTCGAGTTCAAGCTCAACGTTACACCTTCATGTACCAAGAGCCCATGCCGGT
TGAGCAGCTGGTTCAATCTCTTTGTGACACAAAACAAGGATACACACAGTTTGGTGGTCTTCGCCCGTTTGGTGTCTCCT
TTCTCTTTGCAGGATGGGACAAGCACCATGGTTTCCAGCTTTATATGAGTGACCCGAGTGGGAACTATGGTGGTTGGAAA
GCTGCAGCTGTTGGAGCAAACAATCAGGCGGCTCAGTCTATCCTGAAACAAGACTACAAGGACGATGCAACCAGGGAAGA
AGCAGTCGAGCTTGCCTTGAAGGTTCTGACCAAGACAATGGACAGCACTAGCTTAACATCTGAGAAGCTAGAGCTTGCTG
AAGTGTATCTGACTCCATCCAAGACTGTTAAGTACCATGTTCACTCACCTGAGTCGCTCACCAAACTGTTGGTCAAGCAC
GGTGTGACTCAACCCGCTGCTGAAACATCTTAA