Details for Arabidopsis Locus AT3G22100

Position : Chr3 ( 5`- 7783711 .. 7784469 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G22100

Protein [Map View]
METPAYDFDSLTDLPPLPPSDFTPSNAFTFPDHNLDFSFLDSTLSLLNRHHLSESTRLEQIFYDSTHTQLFHNDDTTTTT
TPFLHLPDLKSIDAVEEPTTMKLFPSLSPPLPAAKRQKLNSTSSSTTSGSPTASNDGGIITKRRKISDKIRSLEKLMPWE
RKMNLAMTLEESHKYIKFLQSQIASLRWMPLESVYNTAGEVGETDLLKSLTRQQILQVLANSPGSRNVLSSRGVCVFSYE
QLLSLKTMSRNL*

DNA
ATGGAGACACCAGCTTACGATTTCGACTCACTCACTGACTTACCACCGCTTCCTCCTTCCGATTTCACTCCTTCCAACGC
CTTCACCTTCCCCGACCACAACCTCGACTTTTCCTTCCTCGACTCCACTCTGTCTCTCCTCAATCGGCACCATCTCTCTG
AGTCCACTCGCTTGGAACAGATTTTTTACGACTCCACTCACACTCAGCTCTTTCACAACGACGACACCACCACCACCACC
ACACCGTTTCTCCACCTTCCTGATCTCAAATCCATCGACGCCGTTGAAGAACCGACGACGATGAAGCTGTTTCCATCTCT
CTCTCCTCCTCTTCCCGCCGCCAAACGTCAGAAGCTTAACTCAACTTCCTCTTCAACAACCTCTGGATCTCCAACTGCGT
CAAACGACGGTGGTATTATTACCAAACGACGGAAGATCTCAGACAAAATCAGATCCCTGGAGAAACTCATGCCGTGGGAG
AGAAAGATGAACTTAGCGATGACTCTAGAAGAATCTCACAAATACATCAAGTTTCTTCAATCTCAGATTGCTTCACTCCG
TTGGATGCCTCTCGAATCTGTCTACAACACCGCCGGTGAAGTAGGAGAAACAGATTTGCTCAAATCTCTGACACGTCAAC
AGATTCTTCAGGTTCTTGCGAATTCTCCAGGCTCACGAAACGTACTCTCCTCTCGTGGTGTTTGTGTCTTCTCTTATGAA
CAGCTTCTCTCTCTCAAGACAATGTCGAGAAACCTCTGA